You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDelta(14)-sterol reductase
Synonyms
  • C-14 sterol reductase
  • Sterol C14-reductase
Gene NameERG24
Enzyme Class
Biological Properties
General FunctionInvolved in delta14-sterol reductase activity
Specific FunctionReduces the C14=C15 double bond of 4,4-dimethyl- cholesta-8,14,24-trienol to produce 4,4-dimethyl-cholesta-8,24- dienol
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
4,4-Dimethylcholesta-8,14,24-trienol + NADPH4,4-Dimethyl-5a-cholesta-8,24-dien-3-b-ol + NADP
KEGG Reactions
4,4-Dimethylcholesta-8,14,24-trienol + NADPH + hydronNADP + 4,4-Dimethyl-5a-cholesta-8,24-dien-3-b-ol
Metabolites
YMDB IDNameView
YMDB002684,4-Dimethylcholesta-8,14,24-trienolShow
YMDB002904,4-Dimethyl-5a-cholesta-8,24-dien-3-b-olShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB006034,4-dimethyl-5alpha-cholesta-8,14,24-trien-3beta-olShow
YMDB0060414-demethyllanosterolShow
YMDB00862hydronShow
GO Classification
Component
membrane
cell part
Function
Not Available
Process
Not Available
Gene Properties
Chromosome Locationchromosome 14
LocusYNL280C
Gene Sequence>1317 bp ATGGTATCAGCTTTGAATCCCAGAACTACAGAGTTTGAATTTGGTGGGCTGATTGGTGCC TTAGGCATCAGCATAGGGCTGCCTGTTTTCACTATCATCTTGAATCAAATGATAAGGCCC GATTATTTTATTAAGGGATTTTTCCAGAATTTCGATATAGTTGAGCTTTGGAACGGTATC AAGCCATTGCGCTACTATCTGGGCAATCGTGAATTATGGACTGTCTATTGCCTGTGGTAT GGAATACTGGCAGTTTTGGACGTCATTTTACCGGGCAGAGTCATGAAGGGTGTTCAGTTA AGGGATGGTTCGAAGCTTTCGTATAAGATCAATGGAATTGCCATGTCTACAACTTTGGTC TTAGTTTTGGCTATCAGATGGAAATTGACTGATGGACAATTGCCTGAATTGCAATATCTG TATGAAAATCACGTTAGTTTATGCATAATATCTATTTTGTTTTCGTTCTTTTTGGCGACG TACTGCTATGTTGCCAGCTTCATACCATTGATCTTCAAGAAAAATGGTAATGGCAAAAGG GAAAAGATCTTAGCACTAGGTGGAAATTCAGGAAACATCATTTACGATTGGTTTATTGGT AGAGAACTGAACCCTCGTCTCGGCCCATTAGATATCAAGATGTTTTCAGAGTTGAGACCC GGCATGTTGTTATGGTTACTGATCAATCTTTCCTGTCTGCATCACCATTACCTGAAGACT GGTAAAATCAACGATGCATTGGTCTTGGTTAATTTCTTGCAAGGATTTTACATTTTCGAT GGAGTACTAAACGAGGAAGGTGTATTAACCATGATGGATATCACTACAGATGGGTTTGGT TTCATGCTAGCGTTTGGTGACTTAAGTTTAGTTCCATTCACCTACTCATTACAAGCGCGT TACTTGAGTGTTTCCCCTGTGGAATTGGGATGGGTGAAAGTTGTCGGTATATTAGCCATA ATGTTTTTGGGTTTCCACATCTTCCACTCGGCAAATAAGCAAAAATCTGAGTTTAGACAA GGTAAATTAGAAAATCTAAAAAGTATTCAGACAAAGCGTGGTACAAAGTTATTATGTGAC GGGTGGTGGGCTAAATCACAGCATATCAATTACTTTGGCGATTGGCTGATTTCATTAAGT TGGTGTTTGGCCACCTGGTTCCAAACTCCCTTGACATATTACTACTCGTTGTACTTCGCC ACGTTGTTATTACACCGTCAACAACGTGATGAGCACAAGTGCCGCCTGAAATATGGCGAA AATTGGGAAGAATACGAAAGAAAAGTTCCTTACAAGATCATTCCATATGTTTATTAA
Protein Properties
Pfam Domain Function
Protein Residues438
Protein Molecular Weight50615.0
Protein Theoretical pI9.09
Signalling Regions
  • None
Transmembrane Regions
  • 14-34
  • 72-90
  • 110-127
  • 148-172
  • 243-263
  • 309-328
  • 369-387
Protein Sequence>Delta(14)-sterol reductase MVSALNPRTTEFEFGGLIGALGISIGLPVFTIILNQMIRPDYFIKGFFQNFDIVELWNGI KPLRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQLRDGSKLSYKINGIAMSTTLV LVLAIRWKLTDGQLPELQYLYENHVSLCIISILFSFFLATYCYVASFIPLIFKKNGNGKR EKILALGGNSGNIIYDWFIGRELNPRLGPLDIKMFSELRPGMLLWLLINLSCLHHHYLKT GKINDALVLVNFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQAR YLSVSPVELGWVKVVGILAIMFLGFHIFHSANKQKSEFRQGKLENLKSIQTKRGTKLLCD GWWAKSQHINYFGDWLISLSWCLATWFQTPLTYYYSLYFATLLLHRQQRDEHKCRLKYGE NWEEYERKVPYKIIPYVY
References
External Links
ResourceLink
Saccharomyces Genome Database ERG24
Uniprot IDP32462
Uniprot NameERG24_YEAST
GenBank Gene IDM99419
Genebank Protein ID171143
General Reference
  • Lorenz, R. T., Parks, L. W. (1992). "Cloning, sequencing, and disruption of the gene encoding sterol C-14 reductase in Saccharomyces cerevisiae." DNA Cell Biol 11:685-692.1418625
  • Lai, M. H., Bard, M., Pierson, C. A., Alexander, J. F., Goebl, M., Carter, G. T., Kirsch, D. R. (1994). "The identification of a gene family in the Saccharomyces cerevisiae ergosterol biosynthesis pathway." Gene 140:41-49.8125337
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258