You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAllantoinase
SynonymsNot Available
Gene NameDAL1
Enzyme Class
Biological Properties
General FunctionInvolved in allantoinase activity
Specific FunctionUtilization of purines as secondary nitrogen sources, when primary sources are limiting
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
water + AllantoinAllantoic acid + hydron
Metabolites
YMDB IDNameView
YMDB00199Allantoic acidShow
YMDB00213AllantoinShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
cation binding
nuclease activity
metal ion binding
endonuclease activity
transition metal ion binding
endodeoxyribonuclease activity
zinc ion binding
endodeoxyribonuclease activity, producing 5'-phosphomonoesters
hydrolase activity
allantoinase activity
catalytic activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on ester bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
binding
ion binding
Process
allantoin catabolic process
metabolic process
nitrogen compound metabolic process
amine metabolic process
allantoin metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIR027C
Gene Sequence>1383 bp ATGCCTATCAATGCCATCACTTCCGACCATGTCATTATCAATGGTGCAAATAAACCTGCG ACTATTGTGTATTCGACCGAATCAGGCACGATTCTGGATGTTTTAGAAGGCTCCGTGGTT ATGGAGAAAACTGAGATAACCAAATATGAAATACATACGCTGGAGAACGTATCTCCATGT ACAATTCTGCCTGGACTTGTGGACTCTCATGTTCACTTGAACGAGCCCGGTAGGACTAGC TGGGAAGGATTCGAAACTGGAACTCAAGCTGCTATTAGTGGCGGGGTCACAACGGTGGTT GATATGCCGCTAAATGCTATTCCTCCCACAACAAATGTGGAGAATTTCCGAATTAAATTG GAAGCTGCTGAGGGCCAAATGTGGTGCGATGTTGGGTTTTGGGGTGGACTGGTACCACAC AACTTGCCAGACTTAATTCCGCTTGTCAAAGCTGGCGTTCGCGGGTTCAAAGGATTCTTG CTTGATTCTGGTGTGGAAGAATTCCCTCCAATTGGCAAAGAATATATAGAAGAAGCCTTG AAGGTCTTAGCCGAGGAGGATACCATGATGATGTTTCATGCTGAGTTGCCCAAGGCACAT GAGGACCAACAGCAACCCGAGCAAAGCCATCGTGAATATTCTTCGTTTTTGTCCTCGAGG CCGGATTCTTTCGAAATAGACGCCATCAATTTGATTCTCGAATGCTTGAGAGCCAGAAAT GGACCAGTTCCTCCTGTACATATAGTTCATCTGGCATCAATGAAAGCAATTCCCTTGATC AGAAAGGCACGTGCGTCAGGGCTACCAGTCACAACAGAGACTTGTTTCCACTATTTGTGT ATTGCTGCAGAGCAGATCCCAGACGGAGCCACCTACTTTAAATGTTGTCCACCCATCCGC TCTGAGTCTAATCGCCAAGGCCTATGGGACGCTTTGCGTGAAGGTGTTATAGGCTCAGTA GTGAGCGACCATTCGCCATGCACCCCTGAGTTGAAGAACTTGCAAAAAGGTGACTTTTTC GATTCTTGGGGAGGAATCGCTTCCGTCGGACTAGGTTTGCCATTGATGTTTACCCAAGGC TGCTCTTTGGTCGATATCGTTACATGGTGCTGTAAAAATACATCCCATCAGGTAGGACTA TCTCACCAAAAAGGCACTATAGCTCCCGGGTACGATGCTGATTTGGTGGTATTTGATACT GCAAGTAAACATAAAATAAGTAATTCAAGTGTCTACTTCAAAAACAAATTGACTGCCTAC AACGGGATGACGGTCAAGGGCACAGTTTTGAAAACCATATTAAGAGGCCAGGTGGTATAT ACGAATGCCAACGGAGTCTCGAAAACACCATTGGGTCAAACTTTGCTTGATTCTAGACGT TAA
Protein Properties
Pfam Domain Function
Protein Residues460
Protein Molecular Weight50125.89844
Protein Theoretical pI5.85
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Allantoinase MPINAITSDHVIINGANKPATIVYSTESGTILDVLEGSVVMEKTEITKYEIHTLENVSPC TILPGLVDSHVHLNEPGRTSWEGFETGTQAAISGGVTTVVDMPLNAIPPTTNVENFRIKL EAAEGQMWCDVGFWGGLVPHNLPDLIPLVKAGVRGFKGFLLDSGVEEFPPIGKEYIEEAL KVLAEEDTMMMFHAELPKAHEDQQQPEQSHREYSSFLSSRPDSFEIDAINLILECLRARN GPVPPVHIVHLASMKAIPLIRKARASGLPVTTETCFHYLCIAAEQIPDGATYFKCCPPIR SESNRQGLWDALREGVIGSVVSDHSPCTPELKNLQKGDFFDSWGGIASVGLGLPLMFTQG CSLVDIVTWCCKNTSHQVGLSHQKGTIAPGYDADLVVFDTASKHKISNSSVYFKNKLTAY NGMTVKGTVLKTILRGQVVYTNANGVSKTPLGQTLLDSRR
References
External Links
ResourceLink
Saccharomyces Genome Database DAL1
Uniprot IDP32375
Uniprot NameALN_YEAST
GenBank Gene IDZ38061
Genebank Protein ID557833
General Reference
  • Buckholz, R. G., Cooper, T. G. (1991). "The allantoinase (DAL1) gene of Saccharomyces cerevisiae." Yeast 7:913-923.1803816
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870