You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNeutral trehalase
Synonyms
  • Alpha,alpha-trehalase
  • Alpha,alpha-trehalose glucohydrolase
Gene NameNTH1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionAlpha,alpha-trehalose + H(2)O = 2 D-glucose
Cellular LocationCytoplasm
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Trehalose + waterD-Glucose
KEGG Reactions
water + TrehaloseD-Glucose
Metabolites
YMDB IDNameView
YMDB00008TrehaloseShow
YMDB00286D-GlucoseShow
YMDB00890waterShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
hydrolase activity, hydrolyzing O-glycosyl compounds
trehalase activity
catalytic activity
alpha,alpha-trehalase activity
binding
ion binding
cation binding
metal ion binding
hydrolase activity
calcium ion binding
hydrolase activity, acting on glycosyl bonds
Process
metabolic process
trehalose catabolic process
oligosaccharide metabolic process
disaccharide metabolic process
primary metabolic process
trehalose metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR001C
Gene Sequence>2256 bp ATGAGTCAAGTTAATACAAGCCAAGGACCGGTAGCCCAAGGCCGTCAAAGAAGATTATCA TCACTAAGTGAATTCAATGATCCATTTTCGAACGCAGAAGTCTACTATGGCCCCCCAACA GACCCAAGAAAGCAGAAGCAGGCAAAGCCCGCTAAGATCAACCGTACGAGGACTATGAGT GTTTTCGATAATGTATCTCCTTTCAAGAAAACTGGTTTTGGTAAACTTCAACAGACTAGA CGTGGTTCTGAGGATGACACCTATTCAAGTAGTCAAGGTAATCGTCGTTTCTTTATCGAA GATGTCGATAAAACACTTAATGAACTACTGGCTGCTGAGGATACCGATAAAAATTATCAG ATCACCATCGAGGATACCGGTCCAAAAGTTTTGAAAGTCGGTACCGCAAACTCCTATGGC TATAAGCATATTAATATTAGGGGTACGTATATGTTATCCAATTTGTTGCAGGAACTAACT ATTGCGAAAAGTTTTGGTAGACACCAAATTTTCTTAGATGAAGCTCGTATAAACGAAAAT CCCGTCAACAGATTATCAAGATTGATAAACACACAGTTCTGGAACTCTTTGACCAGGAGA GTTGATCTGAACAACGTAGGCGAAATTGCAAAAGATACCAAGATTGATACGCCGGGGGCA AAAAATCCAAGAATCTATGTTCCTTATGATTGTCCAGAACAATACGAATTTTATGTTCAA GCTTCTCAAATGCATCCATCTTTGAAATTAGAAGTTGAATATTTACCAAAAAAAATAACG GCAGAATACGTCAAATCCGTCAATGATACCCCCGGTTTACTAGCATTGGCTATGGAAGAG CACTTCAATCCTTCTACTGGTGAAAAAACTCTCATTGGTTACCCTTATGCTGTTCCTGGT GGTAGATTCAATGAATTATATGGTTGGGACTCCTATATGATGGCACTAGGTCTCCTAGAA GCCAACAAGACTGATGTTGCAAGAGGTATGGTGGAGCATTTTATTTTTGAGATTAATCAC TATGGAAAAATATTGAATGCTAACAGAAGCTACTATCTATGTAGATCACAGCCCCCATTC TTGACTGAAATGGCCTTGGTAGTATTCAAAAAACTTGGTGGTAGGAGTAATCCCGATGCT GTGGATTTGTTGAAAAGAGCTTTCCAAGCAAGCATAAAAGAGTACAAAACTGTTTGGACC GCATCTCCAAGGCTTGATCCCGAAACAGGCTTATCCAGGTACCATCCTAACGGTCTCGGT ATTCCTCCGGAAACTGAAAGTGATCACTTCGATACCGTTTTACTACCATATGCATCGAAA CACGGCGTTACCTTAGACGAATTTAAGCAACTTTATAACGATGGTAAGATAAAGGAGCCT AAATTGGATGAGTTTTTTCTTCATGACCGTGGCGTTAGAGAATCTGGACACGACACTACA TATAGGTTTGAGGGCGTATGTGCCTACCTGGCCACTATTGACCTGAATTCTCTTCTTTAC AAATACGAGATTGATATTGCGGACTTCATAAAGGAATTCTGCGACGACAAATATGAAGAT CCTTTAGACCATTCTATAACAACTTCAGCTATGTGGAAAGAAATGGCCAAAATCAGACAA GAAAAGATTACCAAATATATGTGGGATGACGAGTCGGGGTTTTTCTTTGACTACAACACA AAAATCAAGCACAGAACGTCATACGAATCCGCAACTACATTCTGGGCATTATGGGCTGGA CTTGCCACGAAGGAGCAAGCACAGAAAATGGTGGAGAAAGCACTACCCAAGTTAGAGATG CTTGGAGGTTTAGCTGCATGTACGGAGCGTTCTCGAGGCCCAATTTCTATTTCGAGACCA ATTAGACAATGGGACTATCCATTTGGTTGGGCACCCCATCAAATTCTTGCTTGGGAAGGC CTCCGTTCTTATGGTTATTTAACTGTAACGAATAGGCTAGCTTATAGATGGCTTTTCATG ATGACAAAGGCTTTTGTCGATTATAATGGTATTGTGGTTGAAAAATATGATGTCACAAGA GGAACAGATCCTCATCGTGTTGAAGCAGAATACGGTAATCAAGGTGCTGACTTTAAAGGG GCAGCTACTGAAGGTTTTGGATGGGTCAATGCCCGTTACATTCTTGGTTTGAAGTATATG AACAGTTACGAAAGAAGAGAGATTGGTGCTTGCATTCCACCAATATCATTCTTTAGCAGT TTAAGGCCTCAAGAAAGAAACCTCTATGGACTATAG
Protein Properties
Pfam Domain Function
Protein Residues751
Protein Molecular Weight85878.5
Protein Theoretical pI7.88
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Neutral trehalase MSQVNTSQGPVAQGRQRRLSSLSEFNDPFSNAEVYYGPPTDPRKQKQAKPAKINRTRTMS VFDNVSPFKKTGFGKLQQTRRGSEDDTYSSSQGNRRFFIEDVDKTLNELLAAEDTDKNYQ ITIEDTGPKVLKVGTANSYGYKHINIRGTYMLSNLLQELTIAKSFGRHQIFLDEARINEN PVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAKNPRIYVPYDCPEQYEFYVQ ASQMHPSLKLEVEYLPKKITAEYVKSVNDTPGLLALAMEEHFNPSTGEKTLIGYPYAVPG GRFNELYGWDSYMMALGLLEANKTDVARGMVEHFIFEINHYGKILNANRSYYLCRSQPPF LTEMALVVFKKLGGRSNPDAVDLLKRAFQASIKEYKTVWTASPRLDPETGLSRYHPNGLG IPPETESDHFDTVLLPYASKHGVTLDEFKQLYNDGKIKEPKLDEFFLHDRGVRESGHDTT YRFEGVCAYLATIDLNSLLYKYEIDIADFIKEFCDDKYEDPLDHSITTSAMWKEMAKIRQ EKITKYMWDDESGFFFDYNTKIKHRTSYESATTFWALWAGLATKEQAQKMVEKALPKLEM LGGLAACTERSRGPISISRPIRQWDYPFGWAPHQILAWEGLRSYGYLTVTNRLAYRWLFM MTKAFVDYNGIVVEKYDVTRGTDPHRVEAEYGNQGADFKGAATEGFGWVNASYILGLKYM NSHARRALGACIPPISFFSSLRPQERNLYGL
References
External Links
ResourceLink
Saccharomyces Genome Database NTH1
Uniprot IDP32356
Uniprot NameTREA_YEAST
GenBank Gene IDX65925
Genebank Protein ID498787
General Reference
  • Kopp, M., Muller, H., Holzer, H. (1993). "Molecular analysis of the neutral trehalase gene from Saccharomyces cerevisiae." J Biol Chem 268:4766-4774.8444853
  • Kopp, M., Nwaka, S., Holzer, H. (1994). "Corrected sequence of the yeast neutral trehalase-encoding gene (NTH1): biological implications." Gene 150:403-404.7821816
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • App, H., Holzer, H. (1989). "Purification and characterization of neutral trehalase from the yeast ABYS1 mutant." J Biol Chem 264:17583-17588.2507544
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956