You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameC-5 sterol desaturase
Synonyms
  • Ergosterol Delta(5,6) desaturase
  • Sterol-C5-desaturase
Gene NameERG3
Enzyme Class
Biological Properties
General FunctionInvolved in iron ion binding
Specific FunctionCatalyzes the introduction of a C-5 double bond in the B ring of ergosterol. May contribute to the regulation of ergosterol biosynthesis
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein (Probable)
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
episterol + hydron + oxygen + Pentane5,7,24(28)-Ergostatrienol + water + ferricytochrome c
5a-cholesta-7,24-dien-3B-ol → 7,8-Didehydrodesmosterol
KEGG Reactions
episterol + NADPH + hydron + oxygenwater + NADP + ergosta-5,7,24(28)-trien-3beta-ol
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00540episterolShow
YMDB00605ergosta-5,7,24(28)-trien-3beta-olShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB014897,8-DidehydrodesmosterolShow
YMDB16246PentaneShow
YMDB16255ferricytochrome cShow
YMDB163215,7,24(28)-ErgostatrienolShow
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
endoplasmic reticulum
Function
catalytic activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
oxidoreductase activity
Process
oxidation reduction
organic acid metabolic process
metabolic process
oxoacid metabolic process
cellular metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
fatty acid biosynthetic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR056W
Gene Sequence>1098 bp ATGGATTTGGTCTTAGAAGTCGCTGACCATTATGTCTTAGACGACTTGTACGCTAAAGTT CTGCCCGCTTCGTTGGCAGCTAATATTCCTGTCAAGTGGCAGAAATTGCTAGGGTTGAAC AGTGGGTTCAGCAATTCTACGATTTTGCAGGAGACTTTGAACTCCAAGAATGCCGTCAAA GAATGTAGAAGGTTCTACGGGCAGGTGCCATTCCTGTTTGATATGTCGACGACGTCTTTT GCATCGCTATTGCCTCGTTCCAGCATCTTGAGAGAATTCCTCTCACTATGGGTTATTGTT ACGATCTTTGGTTTACTACTTTACTTATTCACGGCTAGTCTCAGCTACGTGTTTGTGTTT GACAAGTCGATTTTCAACCATCCTCGTTACTTGAAAAACCAAATGGCAATGGAAATCAAG TTGGCAGTCAGTGCTATCCCATGGATGTCGATGTTGACCGTTCCATGGTTTGTTATGGAA TTGAACGGCCATTCTAAACTATACATGAAGATTGATTATGAAAACCACGGTGTAAGGAAG CTCATTATCGAGTACTTCACTTTCATCTTTTTCACTGATTGCGGTGTGTATTTAGCGCAC AGATGGTTGCATTGGCCAAGGGTCTACCGTGCTCTGCACAAGCCTCATCACAAGTGGCTG GTCTGCACACCTTTCGCATCTCATTCTTTCCATCCTGTAGACGGGTTTTTGCAATCCATC TCGTACCACATCTACCCATTGATTCTGCCATTACACAAGGTTTCTTATTTGATTCTGTTC ACTTTTGTTAACTTTTGGACTGTTATGATTCATGACGGTCAATACCTATCAAACAATCCT GCCGTCAACGGTACTGCCTGCCACACGGTTCACCATCTATATTTCAACTACAACTACGGT CAATTCACCACTCTGTGGGACAGACTAGGGGGTTCTTACCGTAGACCAGATGACTCATTG TTTGATCCTAAGTTAAGAGATGCTAAGGAGACCTGGGACGCTCAAGTTAAGGAAGTTGAA CATTTCATCAAGGAGGTCGAAGGTGATGATAATGATAGAATCTATGAAAACGACCCAAAT ACCAAGAAGAACAACTGA
Protein Properties
Pfam Domain Function
Protein Residues365
Protein Molecular Weight42729.89844
Protein Theoretical pI7.79
Signalling Regions
  • None
Transmembrane Regions
  • 93-113
  • 141-161
  • 243-263
Protein Sequence>C-5 sterol desaturase MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVK ECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVF DKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRK LIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSI SYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYG QFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDDNDRIYENDPN TKKNN
References
External Links
ResourceLink
Saccharomyces Genome Database ERG3
Uniprot IDP32353
Uniprot NameERG3_YEAST
GenBank Gene IDAY692996
Genebank Protein ID51013443
General Reference
  • Arthington, B. A., Bennett, L. G., Skatrud, P. L., Guynn, C. J., Barbuch, R. J., Ulbright, C. E., Bard, M. (1991). "Cloning, disruption and sequence of the gene encoding yeast C-5 sterol desaturase." Gene 102:39-44.1864507
  • Taguchi, N., Takano, Y., Julmanop, C., Wang, Y., Stock, S., Takemoto, J., Miyakawa, T. (1994). "Identification and analysis of the Saccharomyces cerevisiae SYR1 gene reveals that ergosterol is involved in the action of syringomycin." Microbiology 140 ( Pt 2):353-359.8180700
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Mo, C., Bard, M. (2005). "Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex." J Lipid Res 46:1991-1998.15995173
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258