You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial
Synonyms
  • Internal NADH dehydrogenase
Gene NameNDI1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the oxidation of NADH generated inside the Mitochondrion
Cellular LocationMitochondrion inner membrane; Peripheral membrane protein; Matrix side.
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG Reactions
NADH + hydron + Ubiquinone-6NAD + Ubiquinol-6 + hydron
Metabolites
YMDB IDNameView
YMDB00088Ubiquinone Q1Show
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00660Ubiquinone-6Show
YMDB00862hydronShow
YMDB00915Ubiquinol-6Show
GO Classification
Component
Not Available
Function
catalytic activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 13
LocusYML120C
Gene Sequence>1542 bp ATGCTATCGAAGAATTTGTATAGTAACAAGAGGTTGCTCACCTCGACGAATACGCTAGTC AGATTCGCTTCCACCAGATCCACAGGGGTGGAAAACTCCGGAGCAGGTCCTACATCTTTT AAGACCATGAAAGTCATTGACCCTCAGCACAGCGACAAACCAAACGTGCTGATACTGGGT TCGGGGTGGGGAGCTATTTCGTTTTTAAAGCACATTGACACCAAGAAGTACAACGTTTCC ATCATCTCTCCTAGAAGCTATTTCTTATTTACGCCTTTGTTACCTTCTGCACCAGTTGGG ACAGTAGACGAAAAGTCAATTATTGAGCCCATCGTTAATTTTGCTCTCAAGAAAAAGGGG AACGTTACCTACTATGAGGCAGAAGCCACCTCTATCAATCCCGACAGGAATACCGTTACC ATAAAATCATTATCTGCCGTTAGCCAGCTATACCAACCTGAAAACCATCTAGGGCTGCAT CAAGCAGAACCTGCTGAAATTAAGTACGATTATTTAATCAGTGCTGTAGGTGCGGAACCT AACACATTTGGTATTCCTGGGGTCACTGATTACGGTCATTTCCTGAAGGAAATTCCCAAC TCTTTGGAAATAAGAAGAACTTTTGCCGCCAATCTAGAGAAGGCTAACTTATTGCCAAAG GGTGATCCCGAAAGAAGAAGACTACTGTCCATTGTCGTGGTTGGTGGTGGGCCTACTGGT GTAGAGGCCGCTGGTGAACTACAGGATTATGTTCACCAGGACCTGAGAAAGTTTCTCCCT GCATTGGCCGAAGAAGTCCAAATTCACTTGGTCGAAGCTCTGCCCATCGTTTTGAATATG TTTGAGAAAAAGCTTTCATCATACGCGCAATCACATTTAGAAAACACTTCGATCAAAGTA CATCTGAGAACGGCTGTCGCCAAAGTTGAAGAAAAGCAATTGTTGGCAAAGACCAAACAC GAAGACGGTAAAATAACCGAAGAAACTATTCCATACGGTACTTTGATTTGGGCCACGGGT AACAAGGCAAGACCGGTAATCACTGACCTTTTCAAGAAAATTCCTGAGCAAAACTCGTCC AAGAGAGGATTGGCAGTGAATGACTTTTTGCAGGTGAAAGGCAGCAACAACATTTTCGCC ATTGGTGACAATGCATTTGCTGGGTTGCCACCAACCGCCCAAGTAGCGCACCAAGAGGCC GAATATTTGGCCAAGAATTTTGATAAAATGGCTCAAATACCAAATTTCCAAAAGAATCTA TCTTCAAGAAAGGATAAAATTGATCTCTTGTTCGAGGAGAACAACTTTAAACCTTTCAAA TACAACGATTTAGGTGCCTTAGCATACCTGGGATCCGAAAGGGCCATTGCAACCATACGT TCCGGTAAGAGAACATTTTACACCGGTGGTGGCTTAATGACCTTCTACTTATGGAGAATT TTGTACTTGTCCATGATTCTATCTGCAAGATCGAGATTAAAGGTCTTTTTCGACTGGATT AAATTAGCATTTTTCAAAAGAGACTTTTTTAAAGGATTATAG
Protein Properties
Pfam Domain Function
Protein Residues513
Protein Molecular Weight57249.30078
Protein Theoretical pI9.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial MLSKNLYSNKRLLTSTNTLVRFASTRSTGVENSGAGPTSFKTMKVIDPQHSDKPNVLILG SGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKG NVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEP NTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTG VEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKV HLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSS KRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNL SSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRI LYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
References
External Links
ResourceLink
Saccharomyces Genome Database NDI1
Uniprot IDP32340
Uniprot NameNDI1_YEAST
GenBank Gene IDAY723851
Genebank Protein ID51830478
General Reference
  • De Vries, S., Van Witzenburg, R., Grivell, L. A., Marres, C. A. (1992). "Primary structure and import pathway of the rotenone-insensitive NADH-ubiquinone oxidoreductase of mitochondria from Saccharomyces cerevisiae." Eur J Biochem 203:587-592.1735444
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666