You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutamate 5-kinase
Synonyms
  • GK
  • Gamma-glutamyl kinase
Gene NamePRO1
Enzyme Class
Biological Properties
General FunctionInvolved in cellular amino acid biosynthetic process
Specific FunctionCatalyzes the transfer of a phosphate group to glutamate to form glutamate 5-phosphate which rapidly cyclizes to 5- oxoproline
Cellular LocationCytoplasm
SMPDB Pathways
Proline MetabolismPW002365 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB Reactions
L-Glutamic acid + Adenosine triphosphateADP + γ-L-glutamyl 5-phosphate
KEGG Reactions
Adenosine triphosphate + L-Glutamic acidL-Glutamic acid 5-phosphate + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00233L-Glutamic acid 5-phosphateShow
YMDB00271L-Glutamic acidShow
YMDB00914ADPShow
YMDB16257γ-L-glutamyl 5-phosphateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
transferase activity, transferring phosphorus-containing groups
binding
nucleic acid binding
RNA binding
phosphotransferase activity, carboxyl group as acceptor
glutamate 5-kinase activity
catalytic activity
transferase activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
cellular amino acid biosynthetic process
proline metabolic process
proline biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR300C
Gene Sequence>1287 bp ATGAAGGATGCTAATGAGAGTAAATCGTATACTATAGTGATCAAATTAGGCTCTTCATCG CTAGTAGATGAAAAAACCAAAGAACCTAAGTTAGCTATCATGTCGCTTATTGTCGAAACT GTAGTCAAATTGAGAAGAATGGGACACAAAGTTATCATCGTGTCCAGTGGTGGTATTGCT GTTGGTTTGAGGACTATGCGTATGAATAAAAGACCAAAACATTTAGCAGAAGTTCAGGCC ATCGCAGCTATTGGGCAGGGTAGATTGATCGGGAGATGGGATCTTCTGTTTTCGCAATTT GATCAACGTATCGCTCAAATTCTATTGACCAGAAATGATATTCTGGACTGGACCCAATAT AAGAACGCTCAAAACACAATTAATGAATTGTTGAACATGGGCGTTATTCCCATTGTGAAT GAAAACGACACACTATCTGTTAGAGAAATCAAATTTGGTGACAATGACACTTTATCAGCA ATTACTTCTGCTTTAATCCATGCAGATTATCTTTTCTTACTGACAGATGTTGACTGTTTG TATACTGATAATCCAAGGACAAACCCAGATGCCATGCCGATCTTAGTTGTCCCAGATCTC TCAAAGGGTTTGCCCGGTGTGAATACTGCTGGTGGTTCAGGTTCTGACGTTGGGACCGGT GGTATGGAAACTAAATTGGTTGCTGCAGATTTGGCAACGAATGCCGGTGTTCATACGTTG ATCATGAAAAGCGATACACCTGCGAATATAGGTAGAATTGTCGAGTATATGCAAACTCTA GAACTTGACGATGAAAATAAAGTTAAACAAGCATATAATGGCGATTTAACGGATTTGCAA AAAAGAGAATTTGAGAAATTAAAGGCTCTTAACGTTCCACTACATACGAAGTTCATTGCT AATGATAATAAACACCATCTAAAGAATAGAGAGTTTTGGATTTTACACGGTCTTGTCTCT AAAGGCGCTGTTGTTATAGACCAAGGTGCGTACCGAGCCTTAACAAGGAAAAATAAGGCG GGATTATTGCCAGCAGGTGTTATTGATGTTCAGGGCACTTTCCATGAGTTAGAATGTGTT GACATAAAAGTTGGTAAAAAGTTACCAGATGGCACGTTAGATCCAGATTTTCCCTTGCAA ACAGTAGGCAAGGCAAGATGCAATTACACGAGTTCTGAATTAACTAAAATTAAAGGTTTG CACAGTGACCAAATCGAAGAGGAATTGGGCTATAATGACAGCGAATATGTCGCTCATAGA GAAAATTTGGCATTCCCACCTCGTTGA
Protein Properties
Pfam Domain Function
Protein Residues428
Protein Molecular Weight47161.69922
Protein Theoretical pI6.75
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutamate 5-kinase MKDANESKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIA VGLRTMRMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQY KNAQNTINELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCL YTDNPRTNPDAMPILVVPDLSKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTL IMKSDTPANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIA NDNKHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECV DIKVGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHR ENLAFPPR
References
External Links
ResourceLink
Saccharomyces Genome Database PRO1
Uniprot IDP32264
Uniprot NamePROB_YEAST
GenBank Gene IDM85293
Genebank Protein ID172241
General Reference
  • Li, W., Brandriss, M. C. (1992). "Proline biosynthesis in Saccharomyces cerevisiae: molecular analysis of the PRO1 gene, which encodes gamma-glutamyl kinase." J Bacteriol 174:4148-4156.1350780
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106