You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHomoserine dehydrogenase
Synonyms
  • HDH
Gene NameHOM6
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionL-homoserine + NAD(P)(+) = L-aspartate 4- semialdehyde + NAD(P)H
Cellular LocationNot Available
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Glycine, serine and threonine metabolismec00260 Map00260
Lysine biosynthesisec00300 Map00300
SMPDB Reactions
NADPH + L-aspartic 4-semialdehyde + hydronL-Homoserine + NADP
KEGG Reactions
NADH + L-aspartic 4-semialdehyde + hydronNAD + L-Homoserine
L-aspartic 4-semialdehyde + NADPH + hydronNADP + L-Homoserine
Metabolites
YMDB IDNameView
YMDB00034L-aspartic 4-semialdehydeShow
YMDB00104L-HomoserineShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
nucleotide binding
oxidoreductase activity
NADP or NADPH binding
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR139C
Gene Sequence>1080 bp ATGAGCACTAAAGTTGTTAATGTTGCCGTTATCGGTGCCGGTGTTGTTGGTTCAGCTTTC TTGGATCAATTGTTAGCCATGAAGTCTACCATTACTTACAATCTAGTTCTTTTGGCTGAA GCTGAGCGTTCTTTAATCTCCAAGGACTTTTCTCCATTAAATGTTGGTTCTGATTGGAAG GCTGCTTTAGCAGCCTCCACTACTAAAACGTTGCCTTTGGATGATTTAATTGCTCATTTG AAGACTTCACCTAAGCCAGTCATTTTGGTTGATAACACTTCCAGCGCTTACATTGCTGGT TTTTACACTAAGTTTGTCGAAAATGGTATTTCCATTGCTACTCCAAACAAGAAGGCCTTT TCCTCTGATTTGGCTACCTGGAAGGCTCTTTTCTCAAATAAGCCAACTAACGGTTTTGTC TATCATGAAGCTACCGTCGGTGCTGGTTTGCCTATCATCAGTTTCTTAAGAGAAATTATT CAAACCGGTGACGAAGTTGAAAAAATTGAAGGTATCTTCTCTGGTACTCTATCTTATATT TTCAACGAGTTCTCCACTAGTCAAGCTAACGACGTCAAATTCTCTGATGTTGTCAAAGTT GCTAAAAAATTGGGTTATACTGAACCAGATCCAAGAGATGATTTGAATGGGTTGGATGTT GCTAGAAAGGTTACCATTGTTGGTAGGATATCTGGTGTGGAAGTTGAATCTCCAACTTCC TTCCCTGTCCAGTCTTTGATTCCAAAACCATTGGAATCTGTCAAGTCTGCTGATGAATTC TTGGAAAAATTATCTGATTACGATAAAGATTTGACTCAATTGAAGAAGGAAGCTGCCACT GAAAATAAGGTATTGAGATTCATTGGTAAAGTCGATGTTGCCACCAAATCTGTGTCTGTA GGAATTGAAAAGTACGATTACTCACACCCATTCGCATCATTGAAGGGATCAGATAACGTT ATTTCCATCAAGACTAAGCGTTACACCAATCCTGTTGTCATTCAAGGTGCCGGTGCCGGT GCTGCCGTTACTGCCGCTGGTGTTTTGGGTGATGTTATCAAGATTGCTCAAAGACTTTAG
Protein Properties
Pfam Domain Function
Protein Residues359
Protein Molecular Weight38501.69922
Protein Theoretical pI7.71
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Homoserine dehydrogenase MSTKVVNVAVIGAGVVGSAFLDQLLAMKSTITYNLVLLAEAERSLISKDFSPLNVGSDWK AALAASTTKTLPLDDLIAHLKTSPKPVILVDNTSSAYIAGFYTKFVENGISIATPNKKAF SSDLATWKALFSNKPTNGFVYHEATVGAGLPIISFLREIIQTGDEVEKIEGIFSGTLSYI FNEFSTSQANDVKFSDVVKVAKKLGYTEPDPRDDLNGLDVARKVTIVGRISGVEVESPTS FPVQSLIPKPLESVKSADEFLEKLSDYDKDLTQLKKEAATENKVLRFIGKVDVATKSVSV GIEKYDYSHPFASLKGSDNVISIKTKRYTNPVVIQGAGAGAAVTAAGVLGDVIKIAQRL
References
External Links
ResourceLink
Saccharomyces Genome Database HOM6
Uniprot IDP31116
Uniprot NameDHOM_YEAST
GenBank Gene IDX64457
Genebank Protein ID3797
PDB ID
1Q7G
General Reference
  • Thomas, D., Barbey, R., Surdin-Kerjan, Y. (1993). "Evolutionary relationships between yeast and bacterial homoserine dehydrogenases." FEBS Lett 323:289-293.8500624
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Yumoto, N., Kawata, Y., Noda, S., Tokushige, M. (1991). "Rapid purification and characterization of homoserine dehydrogenase from Saccharomyces cerevisiae." Arch Biochem Biophys 285:270-275.1897932
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • DeLaBarre, B., Thompson, P. R., Wright, G. D., Berghuis, A. M. (2000). "Crystal structures of homoserine dehydrogenase suggest a novel catalytic mechanism for oxidoreductases." Nat Struct Biol 7:238-244.10700284
  • Jacques, S. L., Mirza, I. A., Ejim, L., Koteva, K., Hughes, D. W., Green, K., Kinach, R., Honek, J. F., Lai, H. K., Berghuis, A. M., Wright, G. D. (2003). "Enzyme-assisted suicide: molecular basis for the antifungal activity of 5-hydroxy-4-oxonorvaline by potent inhibition of homoserine dehydrogenase." Chem Biol 10:989-995.14583265
  • Ejim, L., Mirza, I. A., Capone, C., Nazi, I., Jenkins, S., Chee, G. L., Berghuis, A. M., Wright, G. D. (2004). "New phenolic inhibitors of yeast homoserine dehydrogenase." Bioorg Med Chem 12:3825-3830.15210149