You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThioredoxin reductase 1
SynonymsNot Available
Gene NameTRR1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionActs on thioredoxins 1 and 2
Cellular LocationCytoplasm
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
Selenocompound metabolismec00450 Map00450
SMPDB Reactions
NADPH + hydron + Methylselenic acidmethylselenol + NADP + water
KEGG Reactions
thioredoxin disulfide + NADPH + hydronNADP + thioredoxin dithiol
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB16312methylselenolShow
YMDB16313Methylselenic acidShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
antioxidant activity
thioredoxin-disulfide reductase activity
catalytic activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
Process
oxidation reduction
oxygen and reactive oxygen species metabolic process
superoxide metabolic process
removal of superoxide radicals
metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR353W
Gene Sequence>960 bp ATGGTTCACAACAAAGTTACTATCATTGGTTCAGGTCCAGCTGCACACACCGCCGCCATC TATTTGGCCAGGGCAGAAATCAAGCCAATCCTATATGAAGGTATGATGGCGAACGGTATT GCTGCCGGTGGCCAGCTAACCACCACTACAGAAATCGAAAACTTCCCAGGTTTCCCAGAT GGTCTAACAGGTAGCGAACTGATGGACAGAATGAGAGAACAATCCACGAAGTTTGGCACT GAAATTATCACGGAAACAGTTTCCAAAGTTGATCTGTCTTCCAAACCATTCAAGCTATGG ACCGAATTTAACGAAGACGCAGAACCTGTGACGACTGACGCTATAATCTTGGCCACAGGC GCTTCTGCTAAGAGAATGCATTTGCCGGGCGAGGAAACCTACTGGCAAAAAGGTATTTCT GCCTGTGCCGTGTGTGATGGTGCCGTCCCCATTTTCAGAAACAAGCCATTGGCCGTCATT GGTGGTGGTGACTCTGCATGTGAAGAAGCTCAGTTCTTGACCAAGTACGGCTCAAAAGTG TTTATGCTTGTCAGAAAAGACCATTTGCGTGCTTCTACCATTATGCAAAAGCGTGCTGAG AAGAACGAAAAAATTGAAATCCTTTACAACACTGTTGCGCTAGAAGCTAAGGGGGATGGT AAATTATTGAATGCCTTGAGGATTAAGAACACTAAAAAGAATGAAGAAACCGATTTGCCT GTCAGCGGTTTATTTTATGCAATTGGCCACACTCCAGCAACAAAGATTGTCGCTGGCCAA GTCGACACTGATGAAGCGGGCTACATTAAAACTGTCCCAGGCAGCTCATTAACCTCCGTT CCAGGATTTTTCGCTGCTGGTGATGTTCAGGATTCTAAATACAGACAAGCTATTACTTCT GCTGGCTCTGGTTGTATGGCCGCTTTGGATGCTGAGAAATACTTAACTTCCCTAGAATAG
Protein Properties
Pfam Domain Function
Protein Residues319
Protein Molecular Weight34237.80078
Protein Theoretical pI5.74
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Thioredoxin reductase 1 MVHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPD GLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATG ASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKV FMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLP VSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITS AGSGCMAALDAEKYLTSLE
References
External Links
ResourceLink
Saccharomyces Genome Database TRR1
Uniprot IDP29509
Uniprot NameTRXB1_YEAST
GenBank Gene IDAY557749
Genebank Protein ID45269389
General Reference
  • Chae, H. Z., Chung, S. J., Rhee, S. G. (1994). "Thioredoxin-dependent peroxide reductase from yeast." J Biol Chem 269:27670-27678.7961686
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Furter, R., Paravicini, G., Aebi, M., Braus, G., Prantl, F., Niederberger, P., Hutter, R. (1986). "The TRP4 gene of Saccharomyces cerevisiae: isolation and structural analysis." Nucleic Acids Res 14:6357-6373.2428012
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956