Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsocitrate dehydrogenase [NAD] subunit 1, mitochondrial
Synonyms
  • Isocitric dehydrogenase
  • NAD(+)-specific ICDH
Gene NameIDH1
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionPerforms an essential role in the oxidative function of the citric acid cycle. Also binds RNA; specifically to the 5'- untranslated leaders of mitochondrial mRNAs
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB00912Carbon dioxideShow
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
mitochondrion
Function
NAD or NADH binding
catalytic activity
magnesium ion binding
oxidoreductase activity, acting on CH-OH group of donors
binding
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
nucleotide binding
ion binding
cation binding
metal ion binding
isocitrate dehydrogenase activity
oxidoreductase activity
isocitrate dehydrogenase (NAD+) activity
Process
oxidation reduction
cofactor metabolic process
coenzyme metabolic process
metabolic process
cellular metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
Gene Properties
Chromosome Locationchromosome 14
LocusYNL037C
Gene Sequence>1083 bp ATGCTTAACAGAACAATTGCTAAGAGAACTTTAGCCACTGCCGCTCAGGCGGAACGCACC CTACCCAAGAAGTATGGCGGTCGTTTCACCGTCACTTTGATACCTGGTGACGGTGTTGGG AAAGAAATCACTGATTCAGTGAGAACCATTTTTGAGGCTGAAAATATCCCGATCGACTGG GAAACTATAAACATTAAGCAAACAGATCATAAGGAAGGCGTCTATGAAGCTGTTGAGTCT CTAAAGAGAAATAAGATTGGTCTTAAGGGGCTATGGCACACTCCTGCTGACCAAACAGGT CACGGTTCACTAAACGTTGCTTTGCGTAAACAACTAGATATCTACGCCAATGTGGCCCTT TTCAAATCCTTGAAGGGTGTCAAGACTAGAATTCCAGACATAGATTTGATTGTCATTAGA GAAAACACGGAGGGTGAGTTCTCAGGCCTGGAACATGAATCCGTCCCTGGTGTAGTGGAA TCTTTGAAAGTTATGACTAGACCTAAGACAGAAAGGATCGCCAGATTTGCCTTTGACTTC GCCAAGAAATACAACAGAAAGTCTGTCACAGCTGTGCATAAGGCAAATATCATGAAGTTA GGTGACGGTCTGTTCAGAAATATAATAACTGAAATTGGCCAAAAAGAATATCCTGATATT GACGTATCGTCCATCATTGTCGACAATGCCTCCATGCAGGCGGTGGCCAAACCTCATCAA TTTGATGTCCTAGTTACCCCTTCAATGTACGGTACCATCTTAGGCAACATTGGCGCTGCT TTGATCGGTGGTCCAGGATTGGTGGCAGGTGCCAACTTTGGCAGGGACTATGCTGTCTTC GAACCAGGTTCCAGACATGTTGGTTTAGATATTAAAGGCCAAAATGTGGCTAACCCAACT GCCATGATCCTTTCCTCCACGTTAATGTTGAACCATTTGGGTTTGAATGAATATGCTACT AGAATCTCAAAGGCAGTTCATGAAACGATCGCAGAAGGTAAGCATACCACTAGAGATATT GGTGGTTCCTCTTCTACTACTGACTTCACGAATGAAATCATCAACAAATTATCTACCATG TAA
Protein Properties
Pfam Domain Function
Protein Residues360
Protein Molecular Weight39323.69922
Protein Theoretical pI9.54
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial MLNRTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDW ETINIKQTDHKEGVYEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVAL FKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDF AKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQ FDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT AMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKLSTM
References
External Links
ResourceLink
Saccharomyces Genome Database IDH1
Uniprot IDP28834
Uniprot NameIDH1_YEAST
GenBank Gene IDM95203
Genebank Protein ID171766
General Reference
  • Cupp, J. R., McAlister-Henn, L. (1992). "Cloning and characterization of the gene encoding the IDH1 subunit of NAD(+)-dependent isocitrate dehydrogenase from Saccharomyces cerevisiae." J Biol Chem 267:16417-16423.1644826
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Keys, D. A., McAlister-Henn, L. (1990). "Subunit structure, expression, and function of NAD(H)-specific isocitrate dehydrogenase in Saccharomyces cerevisiae." J Bacteriol 172:4280-4287.2198251
  • Elzinga, S. D., Bednarz, A. L., van Oosterum, K., Dekker, P. J., Grivell, L. A. (1993). "Yeast mitochondrial NAD(+)-dependent isocitrate dehydrogenase is an RNA-binding protein." Nucleic Acids Res 21:5328-5331.7505425
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106