You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsocitrate dehydrogenase [NAD] subunit 2, mitochondrial
Synonyms
  • Isocitric dehydrogenase
  • NAD(+)-specific ICDH
Gene NameIDH2
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionPerforms an essential role in the oxidative function of the citric acid cycle. Also binds RNA; specifically to the 5'- untranslated leaders of mitochondrial mRNAs
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB00412NAD(+)Show
YMDB00912Carbon dioxideShow
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
mitochondrion
Function
oxidoreductase activity
isocitrate dehydrogenase (NAD+) activity
NAD or NADH binding
catalytic activity
magnesium ion binding
oxidoreductase activity, acting on CH-OH group of donors
binding
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
nucleotide binding
ion binding
cation binding
metal ion binding
isocitrate dehydrogenase activity
Process
oxidation reduction
cofactor metabolic process
coenzyme metabolic process
metabolic process
cellular metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
Gene Properties
Chromosome Locationchromosome 15
LocusYOR136W
Gene Sequence>1110 bp ATGTTGAGAAATACTTTTTTTAGAAACACCTCGAGGAGGTTTTTGGCTACTGTAAAGCAA CCTTCAATCGGAAGATATACCGGCAAACCTAACCCTTCTACCGGCAAATACACGGTCTCG TTCATTGAAGGTGATGGTATCGGACCTGAAATTTCCAAGTCTGTAAAGAAAATCTTTAGT GCAGCAAACGTCCCCATAGAATGGGAATCTTGTGATGTTAGCCCTATCTTTGTCAACGGA TTAACGACCATTCCTGACCCTGCCGTACAATCTATCACAAAAAACCTGGTTGCACTAAAA GGTCCACTAGCTACACCTATTGGTAAAGGTCACAGATCTTTGAATTTGACATTGAGAAAA ACATTTGGGTTATTTGCCAACGTTCGTCCCGCAAAGTCTATTGAAGGTTTTAAGACCACT TACGAAAACGTTGATTTAGTTCTTATCAGAGAGAATACCGAAGGTGAATATTCTGGTATC GAACACATAGTTTGCCCTGGCGTTGTTCAATCTATTAAACTGATCACAAGAGATGCCTCT GAGCGAGTCATTAGATACGCTTTTGAATATGCAAGAGCCATCGGCAGACCAAGAGTTATT GTGGTACATAAATCTACTATCCAGAGATTAGCTGATGGTTTATTCGTTAATGTTGCCAAA GAACTATCCAAAGAGTATCCTGACCTTACTTTAGAAACTGAACTTATTGATAACAGTGTG TTAAAGGTGGTCACCAACCCATCTGCTTACACAGACGCTGTTTCTGTTTGTCCAAATCTA TACGGTGATATCTTGTCCGACTTGAACTCTGGTTTGAGCGCCGGTTCTTTAGGTTTAACT CCATCTGCCAATATTGGTCATAAAATCTCGATCTTTGAAGCTGTCCATGGCTCTGCCCCT GATATTGCCGGTCAAGATAAAGCGAATCCAACTGCCCTACTTTTATCTTCAGTAATGATG TTAAACCACATGGGTCTAACGAATCATGCTGACCAAATTCAAAATGCAGTATTGTCTACT ATCGCATCAGGTCCAGAAAACAGAACAGGTGACTTGGCTGGTACTGCTACTACTTCATCA TTCACTGAAGCAGTCATCAAGAGATTATAA
Protein Properties
Pfam Domain Function
Protein Residues369
Protein Molecular Weight39739.0
Protein Theoretical pI9.01
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS FTEAVIKRL
References
External Links
ResourceLink
Saccharomyces Genome Database IDH2
Uniprot IDP28241
Uniprot NameIDH2_YEAST
GenBank Gene IDM74131
Genebank Protein ID171747
General Reference
  • Cupp, J. R., McAlister-Henn, L. (1991). "NAD(+)-dependent isocitrate dehydrogenase. Cloning, nucleotide sequence, and disruption of the IDH2 gene from Saccharomyces cerevisiae." J Biol Chem 266:22199-22205.1939242
  • Wiemann, S., Rechmann, S., Benes, V., Voss, H., Schwager, C., Vlcek, C., Stegemann, J., Zimmermann, J., Erfle, H., Paces, V., Ansorge, W. (1996). "Sequencing and analysis of 51 kb on the right arm of chromosome XV from Saccharomyces cerevisiae reveals 30 open reading frames." Yeast 12:281-288.8904341
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Keys, D. A., McAlister-Henn, L. (1990). "Subunit structure, expression, and function of NAD(H)-specific isocitrate dehydrogenase in Saccharomyces cerevisiae." J Bacteriol 172:4280-4287.2198251
  • Elzinga, S. D., Bednarz, A. L., van Oosterum, K., Dekker, P. J., Grivell, L. A. (1993). "Yeast mitochondrial NAD(+)-dependent isocitrate dehydrogenase is an RNA-binding protein." Nucleic Acids Res 21:5328-5331.7505425
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956