You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha-1,2 mannosyltransferase KTR1
SynonymsNot Available
Gene NameKTR1
Enzyme Class
Biological Properties
General FunctionInvolved in mannosyltransferase activity
Specific FunctionMannosyltransferase that transfers a mannose residue from GDP-mannose to a range of acceptors in vitro
Cellular LocationGolgi apparatus membrane; Single-pass type II membrane protein
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB ReactionsNot Available
KEGG Reactions
Beta-1,4-D-Mannosylchitobiosyldiphosphodolichol + Guanosine diphosphate mannosealpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol + hydron + Guanosine diphosphate
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00257Guanosine diphosphateShow
YMDB00581alpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
YMDB00862hydronShow
YMDB00935beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
GO Classification
Component
cell part
membrane
Function
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
mannosyltransferase activity
alpha-1,2-mannosyltransferase activity
glycolipid 2-alpha-mannosyltransferase activity
catalytic activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Gene Properties
Chromosome Locationchromosome 15
LocusYOR099W
Gene Sequence>1182 bp ATGGCGAAGATTATGATCCCAGCTAGCAAGCAGCCTGTTTACAAAAAATTAGGACTTCTT CTGGTCGCCGTGTTTACTGTGTATGTGTTCTTTCATGGAGCTCAGTATGCGAGAGGCTCT GCCCCAAGCCCAAAGTACAGTACCGTGCTATCTTCCGGCTCGGGCTATAAATACTCGAAA GTGGAACTACCAAAGTATACCGGTCCTCGGGAAAAGGCCACTTTTGTCACTCTAGTGCGT AATAGAGATCTATATTCGTTGGCTGAGTCTATTAAATCCGTGGAAGATAGATTTAACTCC AAGTTCAACTATGATTGGGTGTTTTTGAATGATGAAGAGTTCACTGATGAATTCAAAAAC GTTACGTCAGCTTTAGTTAGTGGTACAACAAAATACGGTGTCATCCCAAAGGAACATTGG TCCTTCCCTGAGTGGATTGATGAAGAAAAGGCCGCTCAAGTCAGGAAGGAGATGGGTGAG AAGAGAATCATCTACGGTGATTCTATCTCTTACAGACACATGTGTCGTTTTGAATCAGGC TTCTTTTACAGACATCCTTTGATGGATGACTACGATTGGTATTGGCGTGTGGAACCTGAT ATCAAGTTGCACTGTGATATCGACTACGATGTCTTCAAATTCATGAAAGACAATAAGAAA AAGTATGCCTTTGCCATTTCCATTAAGGAGTATGAAGCTACTATCCCCACTTTATGGGAG ACTACTCGTAAATTCATGGAAGCCCATCCTGAGCTTATCCATGAAAATAATATGTTAGAC TTTGTTAGCGACGATCAGGGACTTTCATACAATTTGTGCCATTTTTGGTCTAATTTTGAA ATTGCTGCTTTGGATTTGTGGAGATCTCCAGCATACTCCGCATATTTTGATTATTTAGAT CGTGAAGGTGGATTCTTTTATGAAAGATGGGGTGATGCTCCAGTTCATTCTATTGGTGCT GCGCTGTTCTTGGACCGCTCTGAAATCCATCACTTCGGTGATATTGGTTATTACCATGTT CCATTTCACTCCTGTCCAATAGACACAAGTATCAGACTGGCTAACAAATGTGACTGTGAT CCAAGCAAAGATTTCACATGGCACAGTTATTCATGTACTACTAAATTCTACAATATAAAC AAGTTGCCAAAGCCTGCTGGTTGGCAAAACCATATCGGTTGA
Protein Properties
Pfam Domain Function
Protein Residues393
Protein Molecular Weight46021.69922
Protein Theoretical pI6.67
Signalling Regions
  • None
Transmembrane Regions
  • 17-34
Protein Sequence>Alpha-1,2 mannosyltransferase KTR1 MAKIMIPASKQPVYKKLGLLLVAVFTVYVFFHGAQYARGSAPSPKYSTVLSSGSGYKYSK VELPKYTGPREKATFVTLVRNRDLYSLAESIKSVEDRFNSKFNYDWVFLNDEEFTDEFKN VTSALVSGTTKYGVIPKEHWSFPEWIDEEKAAQVRKEMGEKRIIYGDSISYRHMCRFESG FFYRHPLMDDYDWYWRVEPDIKLHCDIDYDVFKFMKDNKKKYAFAISIKEYEATIPTLWE TTRKFMEAHPELIHENNMLDFVSDDQGLSYNLCHFWSNFEIAALDLWRSPAYSAYFDYLD REGGFFYERWGDAPVHSIGAALFLDRSEIHHFGDIGYYHVPFHSCPIDTSIRLANKCDCD PSKDFTWHSYSCTTKFYNINKLPKPAGWQNHIG
References
External Links
ResourceLink
Saccharomyces Genome Database KTR1
Uniprot IDP27810
Uniprot NameKTR1_YEAST
GenBank Gene IDX62941
Genebank Protein ID3866
General Reference
  • Hill, K., Boone, C., Goebl, M., Puccia, R., Sdicu, A. M., Bussey, H. (1992). "Yeast KRE2 defines a new gene family encoding probable secretory proteins, and is required for the correct N-glycosylation of proteins." Genetics 130:273-283.1541391
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Romero, P. A., Lussier, M., Sdicu, A. M., Bussey, H., Herscovics, A. (1997). "Ktr1p is an alpha-1,2-mannosyltransferase of Saccharomyces cerevisiae. Comparison of the enzymic properties of soluble recombinant Ktr1p and Kre2p/Mnt1p produced in Pichia pastoris." Biochem J 321 ( Pt 2):289-295.9020857
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kung, L. A., Tao, S. C., Qian, J., Smith, M. G., Snyder, M., Zhu, H. (2009). "Global analysis of the glycoproteome in Saccharomyces cerevisiae reveals new roles for protein glycosylation in eukaryotes." Mol Syst Biol 5:308.19756047