Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycogen [starch] synthase isoform 2
SynonymsNot Available
Gene NameGSY2
Enzyme Class
Biological Properties
General FunctionInvolved in glycogen (starch) synthase activity
Specific FunctionTransfers the glycosyl residue from UDP-Glc to the non- reducing end of alpha-1,4-glucan. Is believed to regulate the synthesis of glycogen
Cellular LocationNot Available
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Uridine diphosphate glucoseAmylose + Uridine 5'-diphosphate
Uridine diphosphate glucose + GlycogenUridine 5'-diphosphate + Glycogen
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00862hydronShow
YMDB00881GlycogenShow
YMDB00890waterShow
YMDB16158AmyloseShow
GO Classification
Component
Not Available
Function
UDP-glycosyltransferase activity
catalytic activity
UDP-glucosyltransferase activity
transferase activity
transferase activity, transferring glycosyl groups
glycogen (starch) synthase activity
Process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glycogen metabolic process
glycogen biosynthetic process
metabolic process
small molecule metabolic process
alcohol metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR258W
Gene Sequence>2118 bp ATGTCCCGTGACCTACAAAACCATTTGTTATTCGAGACTGCGACTGAGGTTGCTAATAGG GTTGGTGGTATTTACTCCGTGCTAAAATCGAAGGCTCCCATTACGGTTGCCCAGTATAAA GACCATTACCACTTGATAGGGCCCTTAAATAAAGCCACTTATCAAAATGAAGTTGATATA CTAGATTGGAAGAAGCCTGAGGCCTTTTCCGATGAAATGAGGCCAGTGCAGCATGCCCTG CAAACAATGGAATCTAGAGGAGTTCATTTTGTTTATGGGAGGTGGCTGATTGAAGGTGCT CCAAAAGTAATACTTTTTGACTTGGATTCTGTGAGAGGTTATTCGAATGAATGGAAGGGT GATTTATGGTCATTAGTAGGAATTCCCTCTCCTGAGAATGATTTCGAGACGAATGATGCT ATCCTATTGGGGTATACAGTCGCTTGGTTTCTAGGCGAAGTGGCTCATCTCGATTCACAA CACGCAATTGTTGCGCACTTTCACGAATGGTTGGCCGGTGTTGCGTTACCATTATGCCGT AAAAGGCGTATCGATGTAGTTACCATTTTCACCACTCATGCTACTTTATTGGGACGGTAT TTATGCGCCTCCGGCAGTTTCGATTTTTACAATTGTTTAGAATCTGTTGATGTTGATCAC GAAGCTGGCAGATTTGGCATATACCATCGTTATTGTATAGAGAGAGCGGCGGCTCATTCT GCAGACGTATTCACTACGGTGTCACAAATAACTGCTTTTGAAGCGGAACATCTTTTGAAA AGAAAACCAGATGGGATTTTGCCTAATGGACTGAACGTCATCAAATTTCAAGCATTTCAT GAGTTCCAAAATTTGCATGCTTTGAAAAAAGAAAAAATCAATGACTTTGTAAGAGGCCAT TTTCATGGTTGCTTCGATTTCGATCTAGACAACACCTTGTACTTTTTTATTGCTGGTAGA TATGAGTATAAAAATAAGGGTGCTGACATGTTTATTGAGGCTCTAGCGCGTTTGAACTAC AGATTAAAAGTATCTGGATCCAAAAAAACTGTGGTAGCGTTTATTGTCATGCCCGCCAAA AATAATTCCTTCACTGTTGAAGCATTGAAGGGCCAGGCTGAGGTGAGGGCGTTAGAAAAT ACTGTACACGAAGTGACTACTTCAATTGGTAAAAGAATATTCGATCATGCTATCAGGTAC CCCCACAATGGGCTGACGACGGAATTACCAACCGATTTGGGTGAATTACTAAAGAGTTCG GATAAAGTTATGTTAAAGAGACGTATTTTGGCTTTGAGAAGGCCGGAGGGACAGTTACCC CCAATAGTTACACACAATATGGTCGATGACGCTAATGACCTGATTTTAAATAAAATCAGA CAAGTTCAATTGTTCAATAGCCCAAGTGATCGTGTTAAAATGATCTTCCATCCAGAATTT TTGAACGCTAATAATCCGATCCTTGGTTTAGATTATGATGAGTTCGTTCGTGGTTGCCAT TTGGGTGTTTTCCCTTCATACTACGAGCCTTGGGGTTACACACCTGCAGAATGTACAGTA ATGGGTGTTCCCTCCATCACGACAAATGTCTCTGGCTTCGGTTCCTATATGGAAGACTTG ATCGAAACCAACCAAGCAAAAGATTACGGTATTTATATTGTGGATCGTCGTTTCAAGGCA CCTGATGAATCTGTGGAACAATTAGTTGACTACATGGAAGAATTTGTAAAAAAGACAAGA AGGCAAAGAATTAATCAAAGAAATAGAACTGAAAGACTGTCCGACTTACTGGACTGGAAA AGAATGGGTCTCGAATACGTCAAGGCAAGGCAGTTAGCATTAAGAAGAGGCTATCCTGAT CAGTTCAGAGAGCTCGTTGGTGAAGAACTAAATGATTCCAACATGGATGCTCTAGCAGGC GGAAAGAAATTGAAAGTTGCAAGACCGCTTAGTGTACCTGGCTCACCAAGAGATTTGAGA TCAAACAGCACAGTCTACATGACCCCTGGTGATTTGGGTACTCTGCAGGAGGTTAATAAC GCGGACGATTATTTTTCATTGGGAGTGAATCCTGCAGCTGACGATGACGACGATGGCCCA TATGCTGATGACAGTTAA
Protein Properties
Pfam Domain Function
Protein Residues705
Protein Molecular Weight80078.20313
Protein Theoretical pI6.31
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycogen [starch] synthase isoform 2 MSRDLQNHLLFETATEVANRVGGIYSVLKSKAPITVAQYKDHYHLIGPLNKATYQNEVDI LDWKKPEAFSDEMRPVQHALQTMESRGVHFVYGRWLIEGAPKVILFDLDSVRGYSNEWKG DLWSLVGIPSPENDFETNDAILLGYTVAWFLGEVAHLDSQHAIVAHFHEWLAGVALPLCR KRRIDVVTIFTTHATLLGRYLCASGSFDFYNCLESVDVDHEAGRFGIYHRYCIERAAAHS ADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVIKFQAFHEFQNLHALKKEKINDFVRGH FHGCFDFDLDNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIVMPAK NNSFTVEALKGQAEVRALENTVHEVTTSIGKRIFDHAIRYPHNGLTTELPTDLGELLKSS DKVMLKRRILALRRPEGQLPPIVTHNMVDDANDLILNKIRQVQLFNSPSDRVKMIFHPEF LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDL IETNQAKDYGIYIVDRRFKAPDESVEQLVDYMEEFVKKTRRQRINQRNRTERLSDLLDWK RMGLEYVKARQLALRRGYPDQFRELVGEELNDSNMDALAGGKKLKVARPLSVPGSPRDLR SNSTVYMTPGDLGTLQEVNNADDYFSLGVNPAADDDDDGPYADDS
References
External Links
ResourceLink
Saccharomyces Genome Database GSY2
Uniprot IDP27472
Uniprot NameGYS2_YEAST
GenBank Gene IDM65206
Genebank Protein ID171619
General Reference
  • Farkas, I., Hardy, T. A., Goebl, M. G., Roach, P. J. (1991). "Two glycogen synthase isoforms in Saccharomyces cerevisiae are coded by distinct genes that are differentially controlled." J Biol Chem 266:15602-15607.1908457
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Huang, D., Moffat, J., Wilson, W. A., Moore, L., Cheng, C., Roach, P. J., Andrews, B. (1998). "Cyclin partners determine Pho85 protein kinase substrate specificity in vitro and in vivo: control of glycogen biosynthesis by Pcl8 and Pcl10." Mol Cell Biol 18:3289-3299.9584169
  • Wilson, W. A., Mahrenholz, A. M., Roach, P. J. (1999). "Substrate targeting of the yeast cyclin-dependent kinase Pho85p by the cyclin Pcl10p." Mol Cell Biol 19:7020-7030.10490639
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956