You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative lipase ATG15
Synonyms
  • Autophagy-related protein 15
  • Cytoplasm to vacuole targeting protein 17
Gene NameATG15
Enzyme Class
Biological Properties
General FunctionInvolved in triglyceride lipase activity
Specific FunctionEssential for lysis of subvacuolar cytoplasm to vacuole targeted bodies and intravacuolar autophagic bodies. Involved in the lysis of intravacuolar multivesicular body (MVB) vesicles
Cellular LocationEndoplasmic reticulum membrane; Single-pass type II membrane protein. Golgi apparatus membrane; Single-pass type II membrane protein. Endosome, multivesicular body membrane; Single-pass type II membrane protein. Prevacuolar compartment membrane; Single-pa
SMPDB PathwaysNot Available
KEGG Pathways
Glycerolipid metabolismec00561 Map00561
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00069Palmitic acidShow
YMDB00679myristic acidShow
YMDB00809TG(16:0/16:0/16:0)Show
YMDB00825TrimyristinShow
YMDB008341,3-DipalmitinShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
carboxylesterase activity
triglyceride lipase activity
catalytic activity
Process
lipid metabolic process
metabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCR068W
Gene Sequence>1563 bp ATGTTGCATAAAAGCCCTTCAAGAAAGAGATTTGCTTCTCCTTTGCATCTAGGATGCATT CTAACGCTTACAGTGCTCTGCCTTATTGCTTACTACTTTGCTTTACCGGATTATTTATCG GTAGGGAAGAGCTCATCCAGGGGTGCCATGGATCAAAAATCTGATGGAACCTTTAGACTT AAGTCTATCTACAGGCATGGCGTCGGAGCAAACCATCGGCTACACCAGAGGCTGGAGGTC ACTCCAGAAGTTATTTCTGCCGCTGGAATGCTGTATCAAGAAACCACAACTCAAGGACAG GATTTCGAAGACCAAGAACCCCTATGGACTACTAATGCCGAATATGCCACCACTAACCCA TTCGATTTTGAGTTTGAGCTACGAAGGATGCCGCTATTGATGAAGCGGATGAAGGAAAGA GATCCTGAATTCATAGAGTCGTACATTTACGGAGAAACATACATGACGGAGGAGGAAGAA CACGCCATGTGGATAGATGATGACATTGTGGCACCCAATATCACAGATAGAGGTACAGTA GTGTCGTTAGCATTAATGTCGTCTAATGCTTACGTGAGAATACCGCAAACGGGAGACTGG CGTAACGTCACGGAGCCGTGGAATGAAACAGAGCCGGAAGATTTTGGTTGGGATGGTGAT GGTATACGTGGTCACGTCTTTTACAATGAAGTGGAGAATATCGTGGTACTCTCGATAAAG GGAACCAGCGCTCAGGGTTTGCCAGGGTCTGGCGAAGATGAGACAACTGGAAACGACAAG ATCAACGATAATTTGTTATTTTCGTGTTGTTGTGCAAGAGTGAGCTACCTGTGGACTACC GTGTGCGATTGCTATGTGAAGTCGTATATATGCGATGAGTCTTGCCTGGAAAAGGAACTG AGACGTAAGGATAGATTTTACTCTGCAGTCGTTGACATATACAAAGGCGTCCTCAAAGAA TACCCCGATGCGGCCATATGGGTCACAGGCCACTCACTGGGAGGCGCATTGGCCAGTTTA CTGGGCCGCACTTTTGGATTGCCTGCGGTCGCATTCGAGTCCCCTGGAGAGCTACTACCT TCAAAAAGACTTCACTTACCATTCCCACCGGGACTTCCCTCATACATGGAGGGTATCTGG CACTTCGGTCACAACGCAGACCCAATCTTCATGGGTACATGCAACGGAGCTAGTTCAAGT TGCTCACTGGTGGGCTACGCTATGGAAACCGCGTGCCACACTGGTAGAGTCTGTGTCTAC GATGTGGTCAACGACAAGGGCTGGAGTGTAAACATGTTCAACCACAGAATCCACAAAGTC ATTGACGAAGTTCTCCTTGGATACGAGCAGGCTGCCAAGTGCGTTGAACCAGAGCCCTGC GTAGATTGCTACAACTGGAAGTTTATTCCAAGCAGAGACTGGGAATCCTCATCGAGGCTC ATTACCAAGACTAAAAGCCACGCTGCACCAACCACGACGACTCGCACCACTGCTACTACT ACCTCTTCATCTACCTGTGTAGGCCGCAATTGGCTTGGCTTCTGCACCAAATACGAGTTG TAA
Protein Properties
Pfam Domain Function
Protein Residues520
Protein Molecular Weight58434.5
Protein Theoretical pI5.25
Signalling Regions
  • None
Transmembrane Regions
  • 15-35
Protein Sequence>Putative lipase ATG15 MLHKSPSRKRFASPLHLGCILTLTVLCLIAYYFALPDYLSVGKSSSRGAMDQKSDGTFRL KSIYRHGVGANHRLHQRLEVTPEVISAAGMLYQETTTQGQDFEDQEPLWTTNAEYATTNP FDFEFELRRMPLLMKRMKERDPEFIESYIYGETYMTEEEEHAMWIDDDIVAPNITDRGTV VSLALMSSNAYVRIPQTGDWRNVTEPWNETEPEDFGWDGDGIRGHVFYNEVENIVVLSIK GTSAQGLPGSGEDETTGNDKINDNLLFSCCCARVSYLWTTVCDCYVKSYICDESCLEKEL RRKDRFYSAVVDIYKGVLKEYPDAAIWVTGHSLGGALASLLGRTFGLPAVAFESPGELLP SKRLHLPFPPGLPSYMEGIWHFGHNADPIFMGTCNGASSSCSLVGYAMETACHTGRVCVY DVVNDKGWSVNMFNHRIHKVIDEVLLGYEQAAKCVEPEPCVDCYNWKFIPSRDWESSSRL ITKTKSHAAPTTTTRTTATTTSSSTCVGRNWLGFCTKYEL
References
External Links
ResourceLink
Saccharomyces Genome Database ATG15
Uniprot IDP25641
Uniprot NameATG15_YEAST
GenBank Gene IDX59720
Genebank Protein ID14588952
General Reference
  • Teter, S. A., Eggerton, K. P., Scott, S. V., Kim, J., Fischer, A. M., Klionsky, D. J. (2001). "Degradation of lipid vesicles in the yeast vacuole requires function of Cvt17, a putative lipase." J Biol Chem 276:2083-2087.11085977
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Epple, U. D., Suriapranata, I., Eskelinen, E. L., Thumm, M. (2001). "Aut5/Cvt17p, a putative lipase essential for disintegration of autophagic bodies inside the vacuole." J Bacteriol 183:5942-5955.11566994
  • Epple, U. D., Eskelinen, E. L., Thumm, M. (2003). "Intravacuolar membrane lysis in Saccharomyces cerevisiae. Does vacuolar targeting of Cvt17/Aut5p affect its function?" J Biol Chem 278:7810-7821.12499386
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106