You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification |
---|
Name | Glutaredoxin-1 |
---|
Synonyms | - Glutathione-dependent oxidoreductase 1
|
---|
Gene Name | GRX1 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | Involved in electron carrier activity |
---|
Specific Function | Multifunctional enzyme with glutathione-dependent oxidoreductase, glutathione peroxidase and glutathione S- transferase (GST) activity. The disulfide bond functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. In addition, it is also involved in reducing cytosolic protein- and non-protein-disulfides in a coupled system with glutathione reductase. Required for resistance to reactive oxygen species (ROS) by directly reducing hydroperoxides and for the detoxification of ROS-mediated damage |
---|
Cellular Location | Cytoplasm |
---|
SMPDB Pathways | Not Available |
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | |
---|
Metabolites | YMDB ID | Name | View |
---|
YMDB00057 | Oxidized glutathione | Show | YMDB00160 | Glutathione | Show | YMDB00426 | NADPH | Show | YMDB00427 | NADP | Show | YMDB00693 | glutathione disulfide | Show | YMDB00862 | hydron | Show | YMDB00888 | Hydrogen peroxide | Show | YMDB00890 | water | Show |
|
---|
GO Classification | Component |
---|
Not Available | Function |
---|
catalytic activity | oxidoreductase activity | electron carrier activity | oxidoreductase activity, acting on a sulfur group of donors | disulfide oxidoreductase activity | protein disulfide oxidoreductase activity | Process |
---|
cellular process | cellular homeostasis | cell redox homeostasis |
|
---|
Gene Properties |
---|
Chromosome Location | chromosome 3 |
---|
Locus | YCL035C |
---|
Gene Sequence | >333 bp
ATGGTATCTCAAGAAACTATCAAGCACGTCAAGGACCTTATTGCAGAAAACGAGATCTTC
GTCGCATCCAAAACGTACTGTCCATACTGCCATGCAGCCCTAAACACGCTTTTTGAAAAG
TTAAAGGTTCCCAGGTCCAAAGTTCTGGTTTTGCAATTGAATGACATGAAGGAAGGCGCA
GACATTCAGGCTGCGTTATATGAGATTAATGGCCAAAGAACCGTGCCAAACATCTATATT
AATGGTAAACATATTGGAGGCAACGACGACTTGCAGGAATTGAGGGAGACTGGTGAATTG
GAGGAATTGTTAGAACCTATTCTTGCAAATTAA |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 110 |
---|
Protein Molecular Weight | 12380.09961 |
---|
Protein Theoretical pI | 4.72 |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >Glutaredoxin-1
MVSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGA
DIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPILAN |
---|
References |
---|
External Links | |
---|
General Reference | - Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
- Luikenhuis, S., Perrone, G., Dawes, I. W., Grant, C. M. (1998). "The yeast Saccharomyces cerevisiae contains two glutaredoxin genes that are required for protection against reactive oxygen species." Mol Biol Cell 9:1081-1091.9571241
- Grant, C. M., Luikenhuis, S., Beckhouse, A., Soderbergh, M., Dawes, I. W. (2000). "Differential regulation of glutaredoxin gene expression in response to stress conditions in the yeast Saccharomyces cerevisiae." Biochim Biophys Acta 1490:33-42.10786615
- Collinson, E. J., Wheeler, G. L., Garrido, E. O., Avery, A. M., Avery, S. V., Grant, C. M. (2002). "The yeast glutaredoxins are active as glutathione peroxidases." J Biol Chem 277:16712-16717.11875065
- Collinson, E. J., Grant, C. M. (2003). "Role of yeast glutaredoxins as glutathione S-transferases." J Biol Chem 278:22492-22497.12684511
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
|
---|