You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThioredoxin-3, mitochondrial
SynonymsNot Available
Gene NameTRX3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in electron carrier activity
Specific FunctionNot Available
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
Not Available
Process
cellular homeostasis
cell redox homeostasis
cellular process
Gene Properties
Chromosome Locationchromosome 3
LocusYCR083W
Gene Sequence>384 bp ATGTTGTTCTATAAGCCTGTGATGAGGATGGCGGTGAGACCGCTAAAAAGCATAAGATTC CAGTCCTCATACACCAGTATTACTAAATTGACGAACCTAACAGAATTTAGGAATTTGATC AAGCAAAATGATAAACTAGTCATCGATTTTTATGCTACTTGGTGTGGCCCCTGTAAGATG ATGCAACCACACTTAACGAAATTAATTCAGGCTTATCCAGATGTAAGATTTGTCAAGTGC GACGTGGACGAATCACCAGATATTGCCAAAGAGTGTGAAGTGACGGCTATGCCCACCTTT GTTCTTGGCAAGGATGGCCAACTCATCGGCAAGATCATTGGAGCTAACCCTACTGCTTTA GAGAAGGGAATCAAAGATCTATAA
Protein Properties
Pfam Domain Function
Protein Residues127
Protein Molecular Weight14432.0
Protein Theoretical pI9.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Thioredoxin-3, mitochondrial MLFYKPVMRMAVRPLKSIRFQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKM MQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTAL EKGIKDL
References
External Links
ResourceLink
Saccharomyces Genome Database TRX3
Uniprot IDP25372
Uniprot NameTRX3_YEAST
GenBank Gene IDX59720
Genebank Protein ID1907220
General Reference
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Pedrajas, J. R., Kosmidou, E., Miranda-Vizuete, A., Gustafsson, J. A., Wright, A. P., Spyrou, G. (1999). "Identification and functional characterization of a novel mitochondrial thioredoxin system in Saccharomyces cerevisiae." J Biol Chem 274:6366-6373.10037727
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106