Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDelta(24(24(1)))-sterol reductase
Synonyms
  • C-24(28) sterol reductase
  • Sterol Delta(24(28))-reductase
Gene NameERG4
Enzyme Class
Biological Properties
General FunctionInvolved in delta24(24-1) sterol reductase activity
Specific FunctionErgosterol + NADP(+) = ergosta- 5,7,22,24(24(1))-tetraen-3-beta-ol + NADPH
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Steroid biosynthesisPW002482 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
ergosta-5,7,22,24(28)-tetraen-3beta-ol + hydron + NADPHergosterol + NADP
KEGG Reactions
NADPH + hydron + ergosta-5,7,22,24(28)-tetraen-3beta-olNADP + ergosterol
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00543ergosterolShow
YMDB00606ergosta-5,7,22,24(28)-tetraen-3beta-olShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
Not Available
Process
Not Available
Gene Properties
Chromosome Locationchromosome 7
LocusYGL012W
Gene Sequence>1422 bp ATGGCAAAGGATAATAGTGAGAAGCTGCAGGTGCAGGGAGAGGAGAAAAAGTCCAAGCAA CCGGTTAATTTCCTGCCTCAGGGTAAATGGCTGAAGCCAAATGAAATCGAATATGAGTTT GGTGGGACTACTGGTGTTATTGGTATGCTGATCGGGTTTCCACTGCTAATGTACTATATG TGGATTTGTGCGGAATTTTATCACGGTAAGGTTGCCCTACCCAAGGCTGGTGAATCGTGG ATGCACTTTATCAAGCACCTATACCAGTTAGTCTTGGAGAACGGTATCCCAGAAAAGTAT GACTGGACTATTTTCTTAACATTTTGGGTGTTTCAGATCATTTTCTACTATACGTTGCCC GGGATTTGGACAAAAGGTCAACCATTGTCTCATTTGAAGGGAAAACAATTGCCTTACTTT TGTAATGCCATGTGGACCTTGTATGTAACTACCACTTTGGTCTTGGTTTTGCACTTTACC AATCTTTTTAGATTGTATGTCATTATTGACCGTTTTGGGAGGATCATGACATGTGCCATT ATTTCAGGGTTTGCCTTCTCCATCATATTGTACTTATGGACTTTATTTATCTCACATGAC TATCATAGAATGACAGGAAACCATCTATATGATTTCTTCATGGGAGCTCCACTAAACCCT AGGTGGGGGATTTTGGACTTGAAGATGTTTTTCGAGGTTAGATTACCTTGGTTCACCCTT TACTTTATCACTTTGGGTGCCTGTTTGAAGCAGTGGGAGACTTACGGCTATGTGACACCA CAATTGGGGGTTGTCATGTTAGCTCATTGGTTGTACGCGAACGCATGTGCTAAAGGTGAA GAATTGATTGTTCCAACCTGGGACATGGCTTACGAAAAGTTTGGATTTATGCTGATCTTC TGGAATATTGCCGGTGTCCCATACACTTACTGTCATTGTACGTTGTATTTGTACTACCAT GACCCATCTGAATATCACTGGTCTACACTGTACAATGTTTCGCTGTACGTTGTTCTATTA TGCGCCTACTACTTCTTTGACACGGCAAATGCTCAGAAAAATGCCTTCAGAAAGCAAATG TCTGGTGACAAGACAGTTAGGAAGACTTTCCCATTTTTGCCATACCAAATTTTGAAGAAT CCAAAGTATATGGTTACCTCCAATGGATCGTACCTATTGATTGATGGTTGGTACACTTTG GCTAGAAAAATTCACTACACTGCCGATTGGACTCAATCTCTCGTTTGGGCCTTGTCTTGC GGGTTCAACTCGGTGTTCCCATGGTTTTTCCCAGTATTCTTCCTTGTTGTCCTGATTCAC AGAGCCTTCAGAGACCAAGCAAAATGTAAGAGAAAGTACGGAAAAGATTGGGATGAGTAT TGTAAACATTGCCCTTACGTCTTTATTCCTTATGTTTTCTAG
Protein Properties
Pfam Domain Function
Protein Residues473
Protein Molecular Weight56039.30078
Protein Theoretical pI8.74
Signalling Regions
  • None
Transmembrane Regions
  • 40-64
  • 102-123
  • 139-157
  • 175-197
  • 233-249
  • 327-346
  • 415-439
Protein Sequence>Delta(24(24(1)))-sterol reductase MAKDNSEKLQVQGEEKKSKQPVNFLPQGKWLKPNEIEYEFGGTTGVIGMLIGFPLLMYYM WICAEFYHGKVALPKAGESWMHFIKHLYQLVLENGIPEKYDWTIFLTFWVFQIIFYYTLP GIWTKGQPLSHLKGKQLPYFCNAMWTLYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTCAI ISGFAFSIILYLWTLFISHDYHRMTGNHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTL YFITLGACLKQWETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIF WNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQM SGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLIDGWYTLARKIHYTADWTQSLVWALSC GFNSVFPWFFPVFFLVVLIHRAFRDQAKCKRKYGKDWDEYCKHCPYVFIPYVF
References
External Links
ResourceLink
Saccharomyces Genome Database ERG4
Uniprot IDP25340
Uniprot NameERG4_YEAST
GenBank Gene IDS57891
Genebank Protein ID234325
General Reference
  • Chen, W. N., Capieaux, E., Balzi, E., Goffeau, A. (1991). "The YGL022 gene encodes a putative transport protein." Yeast 7:305-308.1882555
  • Chen, W. N., Balzi, E., Capieaux, E., Choder, M., Goffeau, A. (1991). "The DNA sequencing of the 17 kb HindIII fragment spanning the LEU1 and ATE1 loci on chromosome VII from Saccharomyces cerevisiae reveals the PDR6 gene, a new member of the genetic network controlling pleiotropic drug resistance." Yeast 7:287-299.1882553
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Lai, M. H., Bard, M., Pierson, C. A., Alexander, J. F., Goebl, M., Carter, G. T., Kirsch, D. R. (1994). "The identification of a gene family in the Saccharomyces cerevisiae ergosterol biosynthesis pathway." Gene 140:41-49.8125337
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258