You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycogen [starch] synthase isoform 1
SynonymsNot Available
Gene NameGSY1
Enzyme Class
Biological Properties
General FunctionInvolved in glycogen (starch) synthase activity
Specific FunctionTransfers the glycosyl residue from UDP-Glc to the non- reducing end of alpha-1,4-glucan. Is believed to regulate the synthesis of glycogen
Cellular LocationNot Available
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Uridine diphosphate glucose + GlycogenUridine 5'-diphosphate + Glycogen
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00862hydronShow
YMDB00881GlycogenShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
glycogen (starch) synthase activity
UDP-glycosyltransferase activity
catalytic activity
UDP-glucosyltransferase activity
transferase activity
transferase activity, transferring glycosyl groups
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glycogen metabolic process
glycogen biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFR015C
Gene Sequence>2127 bp ATGGCTCGTGACTTACAAAATCATCTACTGTTCGAAGTAGCAACAGAAGTAACTAACAGG GTTGGTGGTATTTACTCTGTCTTGAAGTCCAAGGCTCCAGTCACTGTGGCACAATACGGA GACAACTATACGCTGCTTGGACCTTTGAACAAGGCGACTTATGAAAGTGAGGTTGAAAAA CTTGACTGGGAAGATGAAAGTATCTTTCCTGAAGAGCTGTTACCGATCCAAAAAACTTTG ATGTCCATGCGGGAAAAGGGTGTGAACTTTGTCTACGGTAACTGGTTGATTGAGGGAGCA CCACGTGTCATTTTATTTGAGCTGGATTCTGTAAGACACTTTTTGAACGAATGGAAGGCT GACCTATGGTCTCTCGTCGGAATTCCATCACCAGAGCATGATCACGAAACAAACGATGCC ATATTGTTGGGTTATGTTGTTGTGTGGTTTTTGGGAGAAGTTTCAAAACTGGACAGTAGC CATGCCATCATTGGCCATTTCCATGAATGGCTAGCTGGTGTAGCCCTGCCATTGTGTAGA AAGAAAAGAATTGATGTTGTAACGATTTTCACCACGCACGCAACTTTATTGGGTAGATAC TTGTGTGCCGCTGGTGATGTAGATTTTTATAACAATCTACAGTATTTTGATGTGGACCAA GAAGCTGGTAAGAGAGGCATATATCATAGGTACTGCATTGAGCGCGCTGCGGCTCATACT GCCGATGTTTTTACGACTGTGTCGCAAATCACTGCATTAGAAGCGGAGCATTTGTTGAAG AGGAAACCGGATGGCATTTTGCCCAATGGTTTGAACGTTGTTAAGTTTCAAGCAGTACAT GAATTTCAAAATCTGCATGCCCTGAAAAAGGACAAAATTAATGATTTCGTCAGAGGCCAT TTCCATGGTTGTTTTGATTTCGATCTAGACAACACAGTTTATTTCTTTATCGCTGGTAGA TATGAATACAAAAACAAAGGTGCTGACATGTTCATTGAATCATTGGCTCGTCTCAATTAC AGATTGAAGGTTTCTGGATCCAAGAAGACGGTGGTAGCGTTTTTGATCATGCCTGCCAAA ACCAATTCCTTCACTGTGGAGGCACTGAAAAGCCAAGCCATTGTAAAATCTTTGGAAAAT ACTGTTAATGAGGTCACCGCATCCATTGGGAAGAGAATTTTCGAGCATACGATGAGATAC CCTCATAATGGCCTAGAATCAGAGTTGCCCACTAATTTAGATGAGCTGTTGAAGAGTTCT GAAAAGGTTTTGCTGAAGAAAAGGGTATTGGCGCTGAGAAGACCTTACGGGGAATTGCCT CCGGTAGTCACACATAACATGTGCGATGATGCTAACGATCCAATTTTAAACCAAATTAGA CATGTTAGATTATTCAATGATTCGAGTGATCGTGTAAAAGTGATTTTCCATCCTGAATTC TTAAACGCCAATAACCCTATCCTTGGTTTGGATTATGACGAGTTTGTTCGCGGCTGTCAC TTGGGTGTTTTTCCATCCTATTACGAACCATGGGGGTACACGCCAGCAGAATGTACCGTC ATGGGTGTCCCATCTATCACAACAAACGTTTCTGGGTTCGGTGCCTACATGGAAGACTTG ATTGAAACAGACCAAGCGAAAGACTATGGTATTTATATTGTAGACCGTCGTTTCAAGAGC CCTGATGAATCTGTCGAGCAATTAGCAGACTACATGGAAGAGTTTGTAAACAAGACCAGA AGACAAAGAATCAACCAAAGAAACAGAACCGAAAGACTATCAGACTTGTTAGATTGGAAG AGAATGGGGTTGGAATACGTTAAGGCTAGACAGTTGGGTCTTCGTAGGGCCTATCCAGAG CAGTTCAAGCAACTGGTGGGTGAAACAATTAGTGACGCCAATATGAATACTCTTGCCGGT GGCAAGAAATTCAAGATTGCCAGGCCTTTGAGTGTACCCGGATCCCCCAAAGTAAGGTCC AATAGTACTGTTTACATGACTCCGGGCGATTTAGGTACCCTTCAAGATGCTAATAATGCA GATGACTATTTTAATTTGAGCACGAATGGAGCCATCGACAATGACGATGATGACAACGAT ACGTCTGCATACTACGAGGATAATTAA
Protein Properties
Pfam Domain Function
Protein Residues708
Protein Molecular Weight80509.60156
Protein Theoretical pI5.9
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycogen [starch] synthase isoform 1 MARDLQNHLLFEVATEVTNRVGGIYSVLKSKAPVTVAQYGDNYTLLGPLNKATYESEVEK LDWEDESIFPEELLPIQKTLMSMREKGVNFVYGNWLIEGAPRVILFELDSVRHFLNEWKA DLWSLVGIPSPEHDHETNDAILLGYVVVWFLGEVSKLDSSHAIIGHFHEWLAGVALPLCR KKRIDVVTIFTTHATLLGRYLCAAGDVDFYNNLQYFDVDQEAGKRGIYHRYCIERAAAHT ADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKDKINDFVRGH FHGCFDFDLDNTVYFFIAGRYEYKNKGADMFIESLARLNYRLKVSGSKKTVVAFLIMPAK TNSFTVEALKSQAIVKSLENTVNEVTASIGKRIFEHTMRYPHNGLESELPTNLDELLKSS EKVLLKKRVLALRRPYGELPPVVTHNMCDDANDPILNQIRHVRLFNDSSDRVKVIFHPEF LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDL IETDQAKDYGIYIVDRRFKSPDESVEQLADYMEEFVNKTRRQRINQRNRTERLSDLLDWK RMGLEYVKARQLGLRRAYPEQFKQLVGETISDANMNTLAGGKKFKIARPLSVPGSPKVRS NSTVYMTPGDLGTLQDANNADDYFNLSTNGAIDNDDDDNDTSAYYEDN
References
External Links
ResourceLink
Saccharomyces Genome Database GSY1
Uniprot IDP23337
Uniprot NameGYS1_YEAST
GenBank Gene IDD50617
Genebank Protein ID836770
General Reference
  • Farkas, I., Hardy, T. A., DePaoli-Roach, A. A., Roach, P. J. (1990). "Isolation of the GSY1 gene encoding yeast glycogen synthase and evidence for the existence of a second gene." J Biol Chem 265:20879-20886.2123485
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956