You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtoheme IX farnesyltransferase, mitochondrial
Synonyms
  • Heme O synthase
Gene NameCOX10
Enzyme Class
Biological Properties
General FunctionInvolved in protoheme IX farnesyltransferase activity
Specific FunctionConverts protoheme IX and farnesyl diphosphate to heme O
Cellular LocationMitochondrion membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
water + Heme + 2-trans,6-trans-farnesyl diphosphatePyrophosphate + heme o
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB003252-trans,6-trans-farnesyl diphosphateShow
YMDB00890waterShow
GO Classification
Component
organelle membrane
cell part
mitochondrial membrane
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transferase activity, transferring alkyl or aryl (other than methyl) groups
prenyltransferase activity
catalytic activity
farnesyltranstransferase activity
transferase activity
protoheme IX farnesyltransferase activity
Process
metabolic process
heme O biosynthetic process
nitrogen compound metabolic process
heme biosynthetic process
tetrapyrrole metabolic process
porphyrin metabolic process
porphyrin biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL172C
Gene Sequence>1389 bp ATGAGTTACTTTCCTCGAACATATGCTCACTTGATGAGAAATGTTCTTGCTCATAATAAA GGGAATATATACTTACAAATTGGTACACAGCTGCACGATACTCAAATAAAAATTCGATTT AATGGAGTTCGTTATATTAGTCGGAATCATGGCGGGAAACAGCAACATATAAACACTGCG CCGATAGAATTTACTCCCAATTTTGGATATGGTGATAGAACCTCTAATTGCAATAAAAAG GTTGAATCGACTGCCATGAAAACGCTAAGATGCACAGATGATATATCAACTTCAAGTGGA AGCGAAGCTACTACCGATGCAAGCACACAACTTCCATTTAATGTCAAACTTGTAGACCCG ATGGTAAGAAAATCTAAGAGACCATCTCACGCAATCAGCGAAGGGCTGAATATGAAAACT TTAAAGAAGAAGGTAATTATGCCATATCTTCAGTTGACCAAGCCCCGACTCACCATTCTA GTGATGTTAAGTGCCATTTGTTCGTATGCTTTATCTCCATATCCAGCCTCCGTCAATGAA TTGTTATGTTTAACAGTAGGCACTACTTTGTGTTCCGGTTCTGCAAACGCTATAAATATG GGCAGAGAGCCAGAATTTGATAGACAAATGGTGAGAACTCAGGCGAGGCCCGTTGTTAGA GGTGATGTTACACCTACCCAGGCATTCGAGTTTGCCGCACTTATCGGAACATTAGGAGTA TCTATCTTGTACTTTGGTGTTAATCCTACCGTTGCTATTCTTGGTGCTTCAAATATCGCG TTATATGGCTGGGCCTATACGTCTATGAAAAGAAAGCATATCATTAACACATGGTTAGGT GCCCTAGTAGGAATGGTACCTCCTCTAATGGGATGGGCAGCCGCAAGTCCGCTTTCACAT CCGGGATCTTGGTGCCTTGCTGGTCTATTGTTTGCTTGGCAATTCCCACACTTTAATACG TTGAGTCATAACATTAGAAATGAATACAAAAATGCCGGATACGTTATGACTGCATGGAAA AATCCGCTCCTAAACGCCCGTGTGTCGTTGAGATACTCTATCCTAATGTTCCCTTTATGT TTCGGATTGTCTTATTTTAATATCACAGATTGGTACTACCAAATAGATTCCGGACTTATA AATGCCTGGCTAACGTTCTGGGCTTTCAAATTCTATTGGCAACAAAGAATCAACTATTCT GCAAAAACATTAAAAGATAACGTCAAGTTTAATAAAGGTCTAAGTGTAGCCAACATTTAT GCAAGGAAAACTTTTATGGCTAGTGTATTGCACCTACCGGCAATTCTAATCCTAGCCATT ATACATAAAAAAGGCCGCTGGGATTGGATATATCCTGGTGAAGCAAAGCGACCACAGGAA CGATTTTAG
Protein Properties
Pfam Domain Function
Protein Residues462
Protein Molecular Weight52147.19922
Protein Theoretical pI10.33
Signalling Regions
  • None
Transmembrane Regions
  • 141-165
  • 180-198
  • 221-239
  • 250-268
  • 338-356
  • 369-386
  • 429-453
Protein Sequence>Protoheme IX farnesyltransferase, mitochondrial MSYFPRTYAHLMRNVLAHNKGNIYLQIGTQLHDTQIKIRFNGVRYISRNHGGKQQHINTA PIEFTPNFGYGDRTSNCNKKVESTAMKTLRCTDDISTSSGSEATTDASTQLPFNVKLVDP MVRKSKRPSHAISEGLNMKTLKKKVIMPYLQLTKPRLTILVMLSAICSYALSPYPASVNE LLCLTVGTTLCSGSANAINMGREPEFDRQMVRTQARPVVRGDVTPTQAFEFAALIGTLGV SILYFGVNPTVAILGASNIALYGWAYTSMKRKHIINTWLGALVGMVPPLMGWAAASPLSH PGSWCLAGLLFAWQFPHFNTLSHNIRNEYKNAGYVMTAWKNPLLNARVSLRYSILMFPLC FGLSYFNITDWYYQIDSGLINAWLTFWAFKFYWQQRINYSAKTLKDNVKFNKGLSVANIY ARKTFMASVLHLPAILILAIIHKKGRWDWIYPGEAKRPQERF
References
External Links
ResourceLink
Saccharomyces Genome Database COX10
Uniprot IDP21592
Uniprot NameCOX10_YEAST
GenBank Gene IDM55566
Genebank Protein ID171265
General Reference
  • Nobrega, M. P., Nobrega, F. G., Tzagoloff, A. (1990). "COX10 codes for a protein homologous to the ORF1 product of Paracoccus denitrificans and is required for the synthesis of yeast cytochrome oxidase." J Biol Chem 265:14220-14226.2167310
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Niino, Y. S., Chakraborty, S., Brown, B. J., Massey, V. (1995). "A new old yellow enzyme of Saccharomyces cerevisiae." J Biol Chem 270:1983-1991.7836424
  • Tzagoloff, A., Nobrega, M., Gorman, N., Sinclair, P. (1993). "On the functions of the yeast COX10 and COX11 gene products." Biochem Mol Biol Int 31:593-598.8118433