Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNAD(+) kinase
Synonyms
  • Unknown transcript 1 protein
Gene NameUTR1
Enzyme Class
Biological Properties
General FunctionInvolved in NAD+ kinase activity
Specific FunctionSpecifically phosphorylates NAD in the presence of ATP, dATP, or CTP as phosphoryl donors
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + NADNADP + hydron + ADP
NADH + Adenosine triphosphateNADPH + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
NAD+ kinase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR049C
Gene Sequence>1593 bp ATGAAGGAGAATGACATGAATAATGGCGTAGATAAATGGGTAAATGAGGAAGATGGTCGA AATGATCATCATAACAACAATAATAACTTGATGAAGAAGGCCATGATGAACAATGAGCAA ATTGATAGAACTCAGGATATCGACAACGCCAAAGAAATGTTGAGGAAAATATCAAGTGAA AGCAGCTCGCGCAGAAGCTCCCTGTTGAATAAAGATTCATCTCTCGTGAACGGCAATGCA AACAGTGGCGGTGGTACGAGCATTAACGGAACAAGAGGAAGTTCTAAGAGTAGTAATACA CACTTTCAGTATGCCTCCACGGCGTATGGTGTAAGAATGTTGAGTAAAGATATATCTAAT ACCAAAGTGGAACTGGATGTGGAAAATTTGATGATTGTTACGAAACTCAACGATGTCTCA CTGTATTTCTTAACAAGAGAGTTGGTAGAATGGGTTTTGGTACATTTTCCACGTGTGACT GTTTATGTGGATTCCGAATTGAAAAACAGCAAAAAATTTGCCGCTGGCGAGTTATGTGAA GATAGTAAATGTAGAGAATCAAGGATCAAGTATTGGACAAAGGATTTCATCAGGGAACAT GATGTTTTCTTCGATTTGGTAGTGACTTTGGGTGGCGACGGTACTGTTCTTTTTGTAAGT TCCATTTTTCAGAGACATGTACCACCCGTTATGTCGTTTTCATTAGGGTCTCTAGGATTT TTAACAAATTTTAAGTTTGAACATTTCAGGGAGGATTTACCTCGGATTATGAATCATAAA ATCAAGACAAATTTACGGTTGAGGTTGGAGTGCACAATTTATCGTAGACACCGCCCTGAA GTAGACCCAAACACGGGGAAGAAAATATGTGTGGTGGAAAAACTAAGCACACACCACATT TTGAACGAAGTGACCATCGATCGTGGTCCAAGTCCTTTTCTATCCATGTTAGAATTGTAT GGTGACGGCTCATTAATGACCGTTGCGCAGGCGGACGGACTGATTGCTGCTACTCCGACT GGGTCCACGGCCTATTCTTTGAGTGCAGGTGGGTCATTGGTATGCCCAACCGTCAATGCA ATCGCTTTAACACCCATTTGTCCACATGCATTGAGTTTCAGACCCATCATCTTACCAGAA AGTATAAATTTAAAAGTGAAAGTCTCGATGAAGTCAAGGGCTCCAGCATGGGCGGCTTTT GATGGGAAAGATAGAATTGAATTGCAAAAAGGTGATTTTATAACCATATGCGCCAGCCCA TATGCTTTTCCAACCGTGGAAGCCTCGCCCGATGAGTTTATTAACAGTATCAGTCGACAA CTAAACTGGAATGTGAGGGAACAACAAAAGTCCTTTACGCATATTTTGTCCCAAAAGAAC CAAGAAAAATATGCACATGAGGCGAACAAAGTCAGAAATCAAGCAGAACCTTTAGAGGTA ATAAGAGATAAATACTCTCTGGAAGCAGACGCTACTAAGGAAAACAACAACGGAAGCGAT GATGAGAGCGACGATGAGAGTGTAAACTGCGAAGCTTGCAAATTAAAGCCTTCGAGCGTC CCAAAACCTTCTCAAGCAAGGTTTTCAGTATAA
Protein Properties
Pfam Domain Function
Protein Residues530
Protein Molecular Weight59468.69922
Protein Theoretical pI7.18
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NAD(+) kinase MKENDMNNGVDKWVNEEDGRNDHHNNNNNLMKKAMMNNEQIDRTQDIDNAKEMLRKISSE SSSRRSSLLNKDSSLVNGNANSGGGTSINGTRGSSKSSNTHFQYASTAYGVRMLSKDISN TKVELDVENLMIVTKLNDVSLYFLTRELVEWVLVHFPRVTVYVDSELKNSKKFAAGELCE DSKCRESRIKYWTKDFIREHDVFFDLVVTLGGDGTVLFVSSIFQRHVPPVMSFSLGSLGF LTNFKFEHFREDLPRIMNHKIKTNLRLRLECTIYRRHRPEVDPNTGKKICVVEKLSTHHI LNEVTIDRGPSPFLSMLELYGDGSLMTVAQADGLIAATPTGSTAYSLSAGGSLVCPTVNA IALTPICPHALSFRPIILPESINLKVKVSMKSRAPAWAAFDGKDRIELQKGDFITICASP YAFPTVEASPDEFINSISRQLNWNVREQQKSFTHILSQKNQEKYAHEANKVRNQAEPLEV IRDKYSLEADATKENNNGSDDESDDESVNCEACKLKPSSVPKPSQARFSV
References
External Links
ResourceLink
Saccharomyces Genome Database UTR1
Uniprot IDP21373
Uniprot NameUTR1_YEAST
GenBank Gene IDAB044344
Genebank Protein ID18181874
General Reference
  • Kawai, S., Suzuki, S., Mori, S., Murata, K. (2001). "Molecular cloning and identification of UTR1 of a yeast Saccharomyces cerevisiae as a gene encoding an NAD kinase." FEMS Microbiol Lett 200:181-184.11425472
  • Melnick, L., Sherman, F. (1990). "Nucleotide sequence of the COR region: a cluster of six genes in the yeast Saccharomyces cerevisiae." Gene 87:157-166.2158927
  • Huang, M. E., Manus, V., Chuat, J. C., Galibert, F. (1994). "Revised nucleotide sequence of the COR region of yeast Saccharomyces cerevisiae chromosome X." Yeast 10:811-818.7975898
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956