You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSerine/threonine-protein phosphatase PP1-1
SynonymsNot Available
Gene NameSIT4
Enzyme ClassNot Available
Biological Properties
General FunctiontRNA wobble uridine modification
Specific FunctionInvolved in the dephosphorylation of the large subunit of RNA polymerase II. Is required in late G1 for normal G1 cyclin expression, bud initiation and expression of certain genes that are periodically expressed during late G1. Associates with the SAP proteins in a cell cycle-dependent manner.
Cellular LocationNot Available
SMPDB Pathways
TOR signalling pathway: Rapamycin based repressionPW002514 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
URE2–GLN3 → Nitrogen regulatory protein GLN3 + Transcriptional regulator URE2 + phosphate
Phosphorylated TIP41 → Type 2A phosphatase activator TIP41 + phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00907phosphateShow
GO Classification
Function
TOR signaling
tRNA wobble uridine modification
metal ion binding
cytoplasm
cell division
actin cytoskeleton organization
intracellular signal transduction
mitotic nuclear division
protein serine/threonine phosphatase activity
cellular response to oxidative stress
dephosphorylation
DNA repair
fungal-type cell wall organization
G1/S transition of mitotic cell cycle
replicative cell aging
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>936 bp ATGGTATCTAGAGGCCCCGACGAATGGCTTGAAACAATAAAGAAATGCCAGGCGCTAACT GAAAACGAGATGAAACAACTGTGTGAAATGGTGAAAGAACTTTTGATGGAGGAAAGTAAC ATCCAGCCGGTACAGACCCCCGTTACTGTATGTGGAGACATACACGGCCAATTTCATGAC TTGTTAGAGCTATTCCGTACGGCGGGTGGCTTTCCTGACGATATAAACTACATTTTTCTC GGTGATTACGTGGATCGTGGCTACTATAGTCTGGAAACTTTTACGCTTTTAATGTGTCTG AAAGTCAAGTACCCGGCAAAGATAACTTTGGTCAGAGGAAACCATGAGTCCAGACAAATT ACTCAAGTTTACGGGTTCTACGAGGAATGCCTGAATAAGTACGGATCTACCACCGTATGG AAGTATTGCTGTCAAGTTTTTGATTTCCTGACGCTGGCCGCTATAATTGACGGTAAGATC TTATGTGTCCATGGAGGGTTATCTCCCGAGATTAGAATGCTCGATCAAATCAGAGTCTTG TCAAGAGCTCAAGAAGTGCCACACGAGGGTGGGTTCTCGGACCTGCTTTGGTCAGACCCT GACAATGTAGAGGCTTGGCAAGTTTCCCCTCGTGGTGCAGGATGGCTCTTTGGCAGTAAA GTTGCTAGAGAGTTTAACCACGTTAATGGACTGAACCTTATTGCCCGGGCTCACCAACTG GTTATGGAGGGGTTCAAGTACCATTTTCCTGAAAAGGACGTTGTAACCGTGTGGTCCGCG CCAAATTACTGTTATAGATGTGGTAATGTCGCGAGTGTAATGAAGGTCGATGAGGATCTG GAACCTACTTTCAAAATTTTCTCGGCTGTTCCCGATGACTACATAAGAGAATCCACGGCA AACCATAATAATCAAAGAGCCGGCTATTTCTTATAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues311
Protein Molecular Weight35537.32
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Serine/threonine-protein phosphatase PP1-1 MVSRGPDEWLETIKKCQALTENEMKQLCEMVKELLMEESNIQPVQTPVTVCGDIHGQFHD LLELFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLMCLKVKYPAKITLVRGNHESRQI TQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKILCVHGGLSPEIRMLDQIRVL SRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLFGSKVAREFNHVNGLNLIARAHQL VMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKVDEDLEPTFKIFSAVPDDYIRESTA NHNNQRAGYFL
References
External Links
ResourceLink
Saccharomyces Genome Database SIT4
Uniprot IDP20604
Uniprot NameSIT4
General ReferenceNot Available