Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name4-aminobutyrate aminotransferase
Synonyms
  • GABA aminotransferase
  • GABA-AT
  • Gamma-amino-N-butyrate transaminase
  • GABA transaminase
Gene NameUGA1
Enzyme Class
Biological Properties
General FunctionInvolved in 4-aminobutyrate transaminase activity
Specific FunctionRequired for the degradation of gamma-aminobutyric acid (GABA), which is important for utilization of GABA as nitrogen source and for oxidative stress tolerance. Deaminates GABA to succinate semialdehyde, which in turn is converted to succinate by the succinate-semialdehyde dehydrogenase UGA2. Cannot transaminate beta-alanine (BAL)
Cellular LocationCytoplasm
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Butanoate metabolismec00650 Map00650
Propanoate metabolismec00640 Map00640
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
4-(Glutamylamino) butanoate + Oxoglutaric acidL-Glutamic acid + Succinic acid semialdehyde
KEGG Reactions
Oxoglutaric acid + gamma-Aminobutyric acidL-Glutamic acid + Succinic acid semialdehyde
Metabolites
YMDB IDNameView
YMDB00153Oxoglutaric acidShow
YMDB00236Succinic acid semialdehydeShow
YMDB00271L-Glutamic acidShow
YMDB00335gamma-Aminobutyric acidShow
YMDB162334-(Glutamylamino) butanoateShow
GO Classification
Component
Not Available
Function
binding
transferase activity, transferring nitrogenous groups
transaminase activity
cofactor binding
catalytic activity
pyridoxal phosphate binding
transferase activity
4-aminobutyrate transaminase activity
Process
cellular amino acid derivative metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
metabolic process
gamma-aminobutyric acid metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR019W
Gene Sequence>1416 bp ATGTCTATTTGTGAACAATACTACCCAGAAGAGCCAACCAAACCAACTGTTAAGACCGAG TCCATTCCTGGTCCTGAATCCCAGAAGCAGTTAAAGGAACTGGGTGAAGTTTTTGACACA AGACCAGCATATTTTTTGGCTGATTATGAGAAATCTTTAGGTAACTATATCACTGATGTG GATGGGAACACATATTTGGATTTGTATGCCCAAATCTCTTCAATTGCACTTGGTTATAAC AACCCTGCTTTGATCAAGGCAGCACAATCACCAGAAATGATCCGTGCTTTGGTCGACCGT CCTGCCTTAGGTAACTTCCCATCTAAGGATTTAGACAAGATATTGAAGCAAATATTGAAA TCTGCGCCAAAGGGTCAAGATCACGTCTGGTCAGGGCTTTCCGGTGCAGATGCCAATGAA TTAGCGTTCAAGGCTGCCTTTATTTATTACCGTGCCAAACAAAGGGGCTATGATGCCGAT TTTTCTGAAAAGGAAAACTTGTCTGTCATGGACAATGACGCCCCTGGCGCCCCTCATCTT GCCGTACTATCGTTCAAGAGAGCGTTCCACGGTAGATTGTTTGCCTCCGGTTCCACAACT TGTTCTAAACCAATTCACAAGTTGGATTTCCCAGCCTTCCACTGGCCTCATGCTGAGTAT CCATCTTACCAATACCCATTAGATGAAAATTCTGATGCAAACCGTAAAGAGGATGACCAT TGCTTGGCCATTGTTGAAGAATTAATCAAAACCTGGTCTATTCCAGTTGCTGCCTTAATC ATCGAACCAATTCAATCTGAGGGAGGTGATAACCACGCTTCTAAGTATTTCTTACAAAAG CTAAGAGACATTACCTTGAAGTATAACGTTGTCTACATCATAGATGAAGTGCAAACAGGT GTCGGAGCCACCGGTAAGCTATGGTGTCATGAGTACGCCGATATTCAACCACCTGTGGAT TTAGTGACCTTTTCCAAGAAATTCCAAAGTGCAGGATATTTCTTCCACGACCCTAAATTC ATTCCAAACAAACCATACAGACAATTCAACACATGGTGTGGTGAACCTGCAAGAATGATC ATTGCAGGTGCCATTGGACAGGAAATCTCCGACAAGAAGTTGACTGAACAATGTTCAAGA GTAGGTGATTATTTGTTCAAGAAATTGGAGGGTTTGCAGAAGAAATACCCTGAAAACTTT CAAAACTTGAGAGGTAAAGGAAGAGGCACATTCATTGCCTGGGATTTGCCTACTGGTGAG AAGAGAGACTTACTATTGAAGAAATTGAAGTTGAATGGTTGCAACGTTGGTGGATGTGCA GTCCATGCAGTGAGATTAAGACCTTCATTAACATTCGAGGAGAAGCATGCTGATATCTTT ATTGAAGCATTAGCCAAATCAGTTAATGAATTATGA
Protein Properties
Pfam Domain Function
Protein Residues471
Protein Molecular Weight52945.69922
Protein Theoretical pI6.79
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>4-aminobutyrate aminotransferase MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDV DGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDRPALGNFPSKDLDKILKQILK SAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGYDADFSEKENLSVMDNDAPGAPHL AVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDH CLAIVEELIKTWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARMI IAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENFQNLRGKGRGTFIAWDLPTGE KRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEALAKSVNEL
References
External Links
ResourceLink
Saccharomyces Genome Database UGA1
Uniprot IDP17649
Uniprot NameGATA_YEAST
GenBank Gene IDAY692904
Genebank Protein ID51013259
General Reference
  • Andre, B., Jauniaux, J. C. (1990). "Nucleotide sequence of the yeast UGA1 gene encoding GABA transaminase." Nucleic Acids Res 18:3049.2190186
  • Andersen, G., Andersen, B., Dobritzsch, D., Schnackerz, K. D., Piskur, J. (2007). "A gene duplication led to specialized gamma-aminobutyrate and beta-alanine aminotransferase in yeast." FEBS J 274:1804-1817.17355287
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ramos, F., el Guezzar, M., Grenson, M., Wiame, J. M. (1985). "Mutations affecting the enzymes involved in the utilization of 4-aminobutyric acid as nitrogen source by the yeast Saccharomyces cerevisiae." Eur J Biochem 149:401-404.3888627
  • Kumar, A., Agarwal, S., Heyman, J. A., Matson, S., Heidtman, M., Piccirillo, S., Umansky, L., Drawid, A., Jansen, R., Liu, Y., Cheung, K. H., Miller, P., Gerstein, M., Roeder, G. S., Snyder, M. (2002). "Subcellular localization of the yeast proteome." Genes Dev 16:707-719.11914276
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Bach, B., Meudec, E., Lepoutre, J. P., Rossignol, T., Blondin, B., Dequin, S., Camarasa, C. (2009). "New insights into {gamma}-aminobutyric acid catabolism: Evidence for {gamma}-hydroxybutyric acid and polyhydroxybutyrate synthesis in Saccharomyces cerevisiae." Appl Environ Microbiol 75:4231-4239.19411412