You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCystine transporter
Synonyms
  • ERD suppressor
  • Transmembrane protein ERS1
Gene NameERS1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in L-cystine transmembrane transporter activity
Specific FunctionTransport cystine out of vacuoles/endodomes
Cellular LocationEndosome membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
YMDB00886L-CystineShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 3
LocusYCR075C
Gene Sequence>783 bp ATGGTGTCGTTAGACGATATACTAGGTATCGTGTATGTTACGTCATGGTCGATATCGATG TATCCACCGATAATCACCAATTGGCGCCATAAGTCAGCGAGCGCGATATCGATGGATTTT GTCATGTTAAATACGGCAGGTTACTCTTACCTGGTCATATCCATATTTTTGCAATTGTAC TGCTGGAAAATGACGGGTGATGAGTCTGACTTGGGCAGGCCCAAGTTGACGCAATTTGAT TTCTGGTATTGCCTGCATGGGTGCTTGATGAATGTTGTCTTATTGACCCAGGTGGTAGCT GGAGCGAGAATCTGGCGATTTCCAGGTAAAGGTCACCGCAAGATGAATCCATGGTACCTA AGGATTTTACTCGCATCACTGGCCATTTTTTCACTGCTAACCGTACAATTTATGTACTCC AACTACTGGTACGATTGGCATAACTCAAGAACTCTGGCGTATTGCAACAATTTGTTTTTA CTCAAAATATCGATGTCACTAATCAAGTACATCCCACAAGTGACGCATAACTCGACAAGA AAATCTATGGATTGTTTCCCCATTCAGGGTGTGTTTCTAGATGTCACTGGCGGTATCGCC TCGCTGCTCCAATTGATTTGGCAGTTGTCTAACGATCAAGGTTTCAGTCTGGATACGTTC GTGACAAATTTTGGAAAAGTGGGACTGTCAATGGTAACTTTAATATTCAACTTCATCTTT ATCATGCAGTGGTTTGTATATCGATCTCGAGGCCATGATCTGGCGTCAGAGTACCCGCTG TAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues260
Protein Molecular Weight30116.0
Protein Theoretical pI8.87
Signalling Regions
  • None
Transmembrane Regions
  • 7-28
  • 40-62
  • 81-102
  • 118-138
  • 151-175
  • 185-205
  • 227-247
Protein Sequence>Cystine transporter MVSLDDILGIVYVTSWSISMYPPIITNWRHKSASAISMDFVMLNTAGYSYLVISIFLQLY CWKMTGDESDLGRPKLTQFDFWYCLHGCLMNVVLLTQVVAGARIWRFPGKGHRKMNPWYL RILLASLAIFSLLTVQFMYSNYWYDWHNSRTLAYCNNLFLLKISMSLIKYIPQVTHNSTR KSMDCFPIQGVFLDVTGGIASLLQLIWQLSNDQGFSLDTFVTNFGKVGLSMVTLIFNFIF IMQWFVYRSRGHDLASEYPL
References
External Links
ResourceLink
Saccharomyces Genome Database ERS1
Uniprot IDP17261
Uniprot NameERS1_YEAST
GenBank Gene IDX52468
Genebank Protein ID3688
General Reference
  • Hardwick, K. G., Pelham, H. R. (1990). "ERS1 a seven transmembrane domain protein from Saccharomyces cerevisiae." Nucleic Acids Res 18:2177.2186379
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Gao, X. D., Wang, J., Keppler-Ross, S., Dean, N. (2005). "ERS1 encodes a functional homologue of the human lysosomal cystine transporter." FEBS J 272:2497-2511.15885099