You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameChitobiosyldiphosphodolichol beta-mannosyltransferase
Synonyms
  • Asparagine-linked glycosylation protein 1
  • Beta-1,4-mannosyltransferase
  • GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase
  • GDP-mannose-dolichol diphosphochitobiose mannosyltransferase
Gene NameALG1
Enzyme Class
Biological Properties
General FunctionInvolved in biosynthetic process
Specific FunctionParticipates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. Involved in assembling the dolichol-pyrophosphate-GlcNAc(2)-Man(5) intermediate on the cytoplasmic surface of the ER
Cellular LocationEndoplasmic reticulum membrane; Single-pass type II membrane protein (Potential)
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB Reactions
(N-Acetylglucosaminyl)2-diphosphodolichol + Guanosine diphosphate mannoseMannosyl-(N-acetylglucosaminyl)2-diphosphodolichol + Guanosine diphosphate + hydron
KEGG Reactions
Guanosine diphosphate mannose + N,N'-diacetylchitobiosyldiphosphodolicholBeta-1,4-D-Mannosylchitobiosyldiphosphodolichol
Metabolites
YMDB IDNameView
YMDB00189Beta-1,4-D-MannosylchitobiosyldiphosphodolicholShow
YMDB00202Guanosine diphosphate mannoseShow
YMDB00257Guanosine diphosphateShow
YMDB00862hydronShow
YMDB00935beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
YMDB00940N,N'-diacetylchitobiosyldiphosphodolicholShow
YMDB16232(N-Acetylglucosaminyl)2-diphosphodolicholShow
YMDB16236Mannosyl-(N-acetylglucosaminyl)2-diphosphodolicholShow
GO Classification
Component
Not Available
Function
Not Available
Process
biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR110W
Gene Sequence>1350 bp ATGTTTTTGGAAATTCCTCGGTGGTTACTTGCCTTAATAATATTATACCTTTCCATACCG TTAGTGGTTTATTATGTTATACCCTACTTGTTTTATGGCAACAAGTCGACCAAAAAAAGG ATCATCATATTTGTGCTGGGTGATGTAGGACACTCTCCAAGGATATGCTATCACGCTATA AGTTTCAGTAAGTTAGGTTGGCAAGTCGAGCTATGCGGTTATGTGGAGGACACTCTACCC AAAATTATTTCCAGTGATCCAAATATCACCGTCCATCATATGTCAAACTTGAAAAGAAAG GGAGGCGGAACATCAGTTATATTTATGGTAAAGAAGGTGCTTTTTCAAGTTTTAAGTATT TTCAAATTACTTTGGGAATTGAGAGGAAGCGATTACATACTAGTTCAAAATCCACCGAGC ATACCCATTCTTCCGATTGCTGTGCTATACAAGTTGACCGGTTGTAAACTAATTATTGAT TGGCACAATCTAGCATATTCGATATTGCAACTAAAATTTAAAGGAAACTTTTACCATCCT TTAGTGTTGATATCTTACATGGTAGAGATGATATTCAGCAAATTTGCTGATTATAACTTG ACTGTTACTGAAGCAATGAGGAAATATTTAATTCAAAGCTTTCACTTGAATCCAAAGAGA TGTGCTGTTCTCTACGACCGCCCGGCTTCCCAATTTCAACCTTTGGCAGGTGACATTTCT CGTCAAAAAGCCCTAACTACCAAAGCCTTTATAAAGAATTATATTCGCGATGATTTTGAT ACAGAAAAAGGCGATAAAATTATTGTGACTTCAACATCATTCACCCCTGATGAAGATATT GGTATTTTATTAGGTGCCCTAAAGATTTACGAAAACTCTTATGTCAAATTTGATTCAAGT TTGCCTAAGATCTTGTGTTTTATAACGGGTAAAGGACCACTAAAGGAGAAATATATGAAG CAAGTAGAAGAATATGACTGGAAGCGCTGTCAAATCGAATTTGTGTGGTTGTCAGCAGAG GATTACCCAAAGTTATTACAATTATGCGATTACGGAGTTTCCCTGCATACTTCAAGTTCA GGGTTGGACCTGCCAATGAAAATTTTAGATATGTTTGGCTCAGGTCTTCCTGTTATTGCA ATGAACTATCCAGTGCTTGACGAATTAGTACAACACAATGTAAATGGGTTAAAATTTGTT GATAGAAGGGAGCTTCATGAATCTCTGATTTTTGCTATGAAAGATGCTGATTTATACCAA AAATTGAAGAAAAATGTAACGCAGGAAGCTGAGAACAGATGGCAATCAAATTGGGAACGA ACAATGAGAGATTTGAAGCTAATTCATTGA
Protein Properties
Pfam Domain Function
Protein Residues449
Protein Molecular Weight51928.5
Protein Theoretical pI9.07
Signalling Regions
  • None
Transmembrane Regions
  • 8-34
Protein Sequence>Chitobiosyldiphosphodolichol beta-mannosyltransferase MFLEIPRWLLALIILYLSIPLVVYYVIPYLFYGNKSTKKRIIIFVLGDVGHSPRICYHAI SFSKLGWQVELCGYVEDTLPKIISSDPNITVHHMSNLKRKGGGTSVIFMVKKVLFQVLSI FKLLWELRGSDYILVQNPPSIPILPIAVLYKLTGCKLIIDWHNLAYSILQLKFKGNFYHP LVLISYMVEMIFSKFADYNLTVTEAMRKYLIQSFHLNPKRCAVLYDRPASQFQPLAGDIS RQKALTTKAFIKNYIRDDFDTEKGDKIIVTSTSFTPDEDIGILLGALKIYENSYVKFDSS LPKILCFITGKGPLKEKYMKQVEEYDWKRCQIEFVWLSAEDYPKLLQLCDYGVSLHTSSS GLDLPMKILDMFGSGLPVIAMNYPVLDELVQHNVNGLKFVDRRELHESLIFAMKDADLYQ KLKKNVTQEAENRWQSNWERTMRDLKLIH
References
External Links
ResourceLink
Saccharomyces Genome Database ALG1
Uniprot IDP16661
Uniprot NameALG1_YEAST
GenBank Gene IDJ05416
Genebank Protein ID171050
General Reference
  • Albright, C. F., Robbins, R. W. (1990). "The sequence and transcript heterogeneity of the yeast gene ALG1, an essential mannosyltransferase involved in N-glycosylation." J Biol Chem 265:7042-7049.2182636
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1994). "Analysis of a 70 kb region on the right arm of yeast chromosome II." Yeast 10:1363-1381.7900426
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gao, X. D., Nishikawa, A., Dean, N. (2004). "Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum." Glycobiology 14:559-570.15044395