You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADPH--cytochrome P450 reductase
Synonyms
  • CPR
  • P450R
Gene NameNCP1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionThis enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5
Cellular LocationEndoplasmic reticulum membrane; Single-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00605ergosta-5,7,24(28)-trien-3beta-olShow
YMDB00606ergosta-5,7,22,24(28)-tetraen-3beta-olShow
YMDB00726N-Formyl-L-tyrosineShow
YMDB00727(S)-2,3-epoxysqualeneShow
YMDB00739N,N'-DiformyldityrosineShow
YMDB00769squaleneShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
nucleotide binding
FMN binding
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
oxidoreductase activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR042W
Gene Sequence>2076 bp ATGCCGTTTGGAATAGACAACACCGACTTCACTGTCCTGGCGGGGCTAGTGCTTGCCGTG CTACTGTACGTAAAGAGAAACTCCATCAAGGAACTGCTGATGTCCGATGACGGAGATATC ACAGCTGTCAGCTCGGGCAACAGGGACATTGCTCAGGTGGTGACCGAAAACAACAAGAAC TACTTGGTGTTGTATGCGTCGCAGACTGGGACTGCCGAGGATTACGCCAAAAAGTTTTCC AAGGAGCTGGTGGCCAAGTTCAACCTAAACGTGATGTGCGCAGATGTTGAGAACTACGAC TTTGAGTCGCTAAACGATGTGCCCGTCATAGTCTCGATTTTTATCTCTACATATGGTGAA GGAGACTTCCCCGACGGGGCGGTCAACTTTGAAGACTTTATTTGTAATGCGGAAGCGGGT GCACTATCGAACCTGAGGTATAATATGTTTGGTCTGGGAAATTCTACTTATGAATTCTTT AATGGTGCCGCCAAGAAGGCCGAGAAGCATCTCTCCGCCGCGGGCGCTATCAGACTAGGC AAGCTCGGTGAAGCTGATGATGGTGCAGGAACTACAGACGAAGATTACATGGCCTGGAAG GACTCCATCCTGGAGGTTTTGAAAGACGAACTGCATTTGGACGAACAGGAAGCCAAGTTC ACCTCTCAATTCCAGTACACTGTGTTGAACGAAATCACTGACTCCATGTCGCTTGGTGAA CCCTCTGCTCACTATTTGCCCTCGCATCAGTTGAACCGCAACGCAGACGGCATCCAATTG GGTCCCTTCGATTTGTCTCAACCGTATATTGCACCCATCGTGAAATCTCGCGAACTGTTC TCTTCCAATGACCGTAATTGCATCCACTCTGAATTTGACTTGTCCGGCTCTAACATCAAG TACTCCACTGGTGACCATCTTGCTGTTTGGCCTTCCAACCCATTGGAAAAGGTCGAACAG TTCTTATCCATATTCAACCTGGACCCTGAAACCATTTTTGACTTGAAGCCCCTGGATCCC ACCGTCAAAGTGCCCTTCCCAACGCCAACTACTATTGGCGCTGCTATTAAACACTATTTG GAAATTACAGGACCTGTCTCCAGACAATTGTTTTCATCTTTGATTCAGTTCGCCCCCAAC GCTGACGTCAAGGAAAAATTGACTCTGCTTTCGAAAGACAAGGACCAATTCGCCGTCGAG ATAACCTCCAAATATTTCAACATCGCAGATGCTCTGAAATATTTGTCTGATGGCGCCAAA TGGGACACCGTACCCATGCAATTCTTGGTCGAATCAGTTCCCCAAATGACTCCTCGTTAC TACTCTATCTCTTCCTCTTCTCTGTCTGAAAAGCAAACCGTCCATGTCACCTCCATTGTG GAAAACTTTCCTAACCCAGAATTGCCTGATGCTCCTCCAGTTGTTGGTGTTACGACTAAC TTGTTAAGAAACATTCAATTGGCTCAAAACAATGTTAACATTGCCGAAACTAACCTACCT GTTCACTACGATTTAAATGGCCCACGTAAACTTTTCGCCAATTACAAATTGCCCGTCCAC GTTCGTCGTTCTAACTTCAGATTGCCTTCCAACCCTTCCACCCCAGTTATCATGATCGGT CCAGGTACCGGTGTTGCCCCATTCCGTGGGTTTATCAGAGAGCGTGTCGCGTTCCTCGAA TCACAAAAGAAGGGCGGTAACAACGTTTCGCTAGGTAAGCATATACTGTTTTATGGATCC CGTAACACTGATGATTTCTTGTACCAGGACGAATGGCCAGAATACGCCAAAAAATTGGAT GGTTCGTTCGAAATGGTCGTGGCCCATTCCAGGTTGCCAAACACCAAAAAAGTCTATGTT CAAGATAAATTAAAGGATTACGAAGACCAAGTATTTGAAATGATTAACAACGGTGCATTT ATCTACGTCTGTGGTGATGCAAAGGGTATGGCCAAGGGTGTGTCAACCGCATTGGTTGGC ATCTTATCCCGTGGTAAATCCATTACCACTGATGAAGCAACAGAGCTAATCAAGATGCTC AAGACTTCAGGTAGATACCAAGAAGATGTCTGGTAA
Protein Properties
Pfam Domain Function
Protein Residues691
Protein Molecular Weight76771.10156
Protein Theoretical pI4.8
Signalling Regions
  • None
Transmembrane Regions
  • 8-24
Protein Sequence>NADPH--cytochrome P450 reductase MPFGIDNTDFTVLAGLVLAVLLYVKRNSIKELLMSDDGDITAVSSGNRDIAQVVTENNKN YLVLYASQTGTAEDYAKKFSKELVAKFNLNVMCADVENYDFESLNDVPVIVSIFISTYGE GDFPDGAVNFEDFICNAEAGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSAAGAIRLG KLGEADDGAGTTDEDYMAWKDSILEVLKDELHLDEQEAKFTSQFQYTVLNEITDSMSLGE PSAHYLPSHQLNRNADGIQLGPFDLSQPYIAPIVKSRELFSSNDRNCIHSEFDLSGSNIK YSTGDHLAVWPSNPLEKVEQFLSIFNLDPETIFDLKPLDPTVKVPFPTPTTIGAAIKHYL EITGPVSRQLFSSLIQFAPNADVKEKLTLLSKDKDQFAVEITSKYFNIADALKYLSDGAK WDTVPMQFLVESVPQMTPRYYSISSSSLSEKQTVHVTSIVENFPNPELPDAPPVVGVTTN LLRNIQLAQNNVNIAETNLPVHYDLNGPRKLFANYKLPVHVRRSNFRLPSNPSTPVIMIG PGTGVAPFRGFIRERVAFLESQKKGGNNVSLGKHILFYGSRNTDDFLYQDEWPEYAKKLD GSFEMVVAHSRLPNTKKVYVQDKLKDYEDQVFEMINNGAFIYVCGDAKGMAKGVSTALVG ILSRGKSITTDEATELIKMLKTSGRYQEDVW
References
External Links
ResourceLink
Saccharomyces Genome Database NCP1
Uniprot IDP16603
Uniprot NameNCPR_YEAST
GenBank Gene IDAY693091
Genebank Protein ID51013633
General Reference
  • Yabusaki, Y., Murakami, H., Ohkawa, H. (1988). "Primary structure of Saccharomyces cerevisiae NADPH-cytochrome P450 reductase deduced from nucleotide sequence of its cloned gene." J Biochem 103:1004-1010.3139648
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538
  • Keniry, M. E., Kemp, H. A., Rivers, D. M., Sprague, G. F. Jr (2004). "The identification of Pcl1-interacting proteins that genetically interact with Cla4 may indicate a link between G1 progression and mitotic exit." Genetics 166:1177-1186.15082539
  • Lamb, D. C., Kim, Y., Yermalitskaya, L. V., Yermalitsky, V. N., Lepesheva, G. I., Kelly, S. L., Waterman, M. R., Podust, L. M. (2006). "A second FMN binding site in yeast NADPH-cytochrome P450 reductase suggests a mechanism of electron transfer by diflavin reductases." Structure 14:51-61.16407065