You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSiroheme biosynthesis protein MET8
Synonyms
  • Precorrin-2 dehydrogenase
  • Sirohydrochlorin ferrochelatase
Gene NameMET8
Enzyme Class
Biological Properties
General FunctionInvolved in binding
Specific FunctionCatalyzes the conversion of precorrin-2 into siroheme. This reaction consist of the NAD-dependent oxidation of precorrin- 2 into sirohydrochlorin and its subsequent ferrochelation into siroheme
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
NADP + Precorrin-2Sirohydrochlorin + NADPH + hydron
Sirohydrochlorin + Iron(2+)hydron + Siroheme
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00249SirohydrochlorinShow
YMDB00379Iron(2+)Show
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00968SirohemeShow
YMDB00977Precorrin-2Show
GO Classification
Component
Not Available
Function
binding
catalytic activity
Process
metabolic process
nitrogen compound metabolic process
tetrapyrrole metabolic process
porphyrin metabolic process
porphyrin biosynthetic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR213W
Gene Sequence>825 bp ATGGTCAAATCGCTACAGCTAGCCCATCAATTAAAAGACAAGAAAATACTACTAATCGGA GGCGGAGAAGTCGGCTTGACAAGGTTATATAAGCTGATACCTACAGGTTGCAAGCTGACT TTAGTATCTCCTGACCTACACAAATCCATTATTCCGAAGTTTGGAAAATTCATCCAGAAC GAGGATCAGCCCGACTACAGAGAAGACGCTAAACGCTTTATCAATCCGAACTGGGACCCC ACGAAGAATGAAATTTACGAGTACATCCGCAGTGACTTCAAAGACGAATACCTCGACCTA GAAGACGAGAACGACGCGTGGTACATAATAATGACCTGTATACCCGACCACCCTGAAAGC GCAAGAATATATCACCTTTGTAAGGAAAGATTCGGTAAGCAGCAGCTGGTCAATGTGGCG GACAAACCTGATCTCTGTGACTTTTATTTCGGCGCCAACCTGGAGATAGGAGACCGTCTA CAGATTCTGATCTCTACCAACGGCCTTTCTCCGCGCTTTGGCGCTCTAGTAAGAGATGAG ATCCGTAACTTATTCACACAAATGGGGGATCTGGCGCTGGAGGACGCTGTCGTCAAACTA GGTGAGCTGAGAAGAGGAATTAGGCTGCTGGCACCAGACGACAAGGATGTCAAGTACCGC ATGGATTGGGCCAGACGCTGCACAGACCTCTTCGGCATTCAGCACTGCCACAACATCGAC GTAAAACGTCTGCTGGATCTTTTCAAGGTCATGTTTCAAGAACAGAACTGTTCCTTGCAG TTCCCTCCCAGAGAACGGTTGCTTAGCGAGTACTGCTCGTCTTGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues274
Protein Molecular Weight31917.40039
Protein Theoretical pI6.26
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Siroheme biosynthesis protein MET8 MVKSLQLAHQLKDKKILLIGGGEVGLTRLYKLIPTGCKLTLVSPDLHKSIIPKFGKFIQN EDQPDYREDAKRFINPNWDPTKNEIYEYIRSDFKDEYLDLEDENDAWYIIMTCIPDHPES ARIYHLCKERFGKQQLVNVADKPDLCDFYFGANLEIGDRLQILISTNGLSPRFGALVRDE IRNLFTQMGDLALEDAVVKLGELRRGIRLLAPDDKDVKYRMDWARRCTDLFGIQHCHNID VKRLLDLFKVMFQEQNCSLQFPPRERLLSEYCSS
References
External Links
ResourceLink
Saccharomyces Genome Database MET8
Uniprot IDP15807
Uniprot NameMET8_YEAST
GenBank Gene IDX17271
Genebank Protein ID3934
PDB ID
1KYQ
General Reference
  • Cherest, H., Thomas, D., Surdin-Kerjan, Y. (1990). "Nucleotide sequence of the MET8 gene of Saccharomyces cerevisiae." Nucleic Acids Res 18:659.2408020
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Raux, E., McVeigh, T., Peters, S. E., Leustek, T., Warren, M. J. (1999). "The role of Saccharomyces cerevisiae Met1p and Met8p in sirohaem and cobalamin biosynthesis." Biochem J 338 ( Pt 3):701-708.10051442
  • Schubert, H. L., Raux, E., Brindley, A. A., Leech, H. K., Wilson, K. S., Hill, C. P., Warren, M. J. (2002). "The structure of Saccharomyces cerevisiae Met8p, a bifunctional dehydrogenase and ferrochelatase." EMBO J 21:2068-2075.11980703