You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGuanylate kinase
Synonyms
  • GMP kinase
Gene NameGUK1
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionEssential for recycling GMP and indirectly, cGMP
Cellular LocationNot Available
SMPDB Pathways
purine nucleotides de novo biosynthesisPW002478 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB Reactions
Guanosine monophosphate + Adenosine triphosphateADP + Guanosine diphosphate
KEGG Reactions
Adenosine triphosphate + dGMPADP + dGDP
Guanosine monophosphate + Adenosine triphosphateADP + Guanosine diphosphate
Guanosine monophosphate + dATPdADP + Guanosine diphosphate
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00257Guanosine diphosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00506dGMPShow
YMDB00700dATPShow
YMDB00898dGDPShow
YMDB00901dADPShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, phosphate group as acceptor
guanylate kinase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR454C
Gene Sequence>564 bp ATGTCCCGTCCTATCGTAATTTCTGGCCCAAGTGGTACAGGTAAATCTACACTGTTGAAG AAATTGTTCGCTGAATACCCAGATTCTTTCGGGTTTAGTGTTTCATCCACTACTAGAACC CCAAGAGCTGGCGAAGTAAACGGTAAGGACTATAACTTTGTCTCCGTAGATGAATTCAAA TCTATGATTAAGAACAATGAATTCATTGAATGGGCGCAATTCTCCGGTAACTACTATGGT AGTACTGTCGCTTCCGTCAAACAAGTCAGTAAATCTGGTAAGACTTGTATTTTAGATATT GATATGCAGGGTGTCAAATCTGTCAAGGCTATCCCAGAGTTAAATGCCAGGTTTTTGTTT ATTGCTCCACCATCGGTCGAGGATTTGAAAAAAAGATTAGAAGGTAGAGGTACGGAGACC GAAGAATCCATCAACAAGAGGTTAAGCGCCGCTCAAGCTGAATTGGCATATGCTGAGACA GGTGCCCATGACAAAGTTATTGTCAATGATGATTTGGACAAGGCCTACAAGGAATTGAAG GATTTTATCTTTGCAGAAAAATGA
Protein Properties
Pfam Domain Function
Protein Residues187
Protein Molecular Weight20637.19922
Protein Theoretical pI7.34
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Guanylate kinase MSRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFK SMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLF IAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELK DFIFAEK
References
External Links
ResourceLink
Saccharomyces Genome Database GUK1
Uniprot IDP15454
Uniprot NameKGUA_YEAST
GenBank Gene IDL04683
Genebank Protein ID171625
PDB ID
1EX7
General Reference
  • Konrad, M. (1992). "Cloning and expression of the essential gene for guanylate kinase from yeast." J Biol Chem 267:25652-25655.1334480
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Berger, A., Schiltz, E., Schulz, G. E. (1989). "Guanylate kinase from Saccharomyces cerevisiae. Isolation and characterization, crystallization and preliminary X-ray analysis, amino acid sequence and comparison with adenylate kinases." Eur J Biochem 184:433-443.2551688
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Stehle, T., Schulz, G. E. (1990). "Three-dimensional structure of the complex of guanylate kinase from yeast with its substrate GMP." J Mol Biol 211:249-254.1967656
  • Stehle, T., Schulz, G. E. (1992). "Refined structure of the complex between guanylate kinase and its substrate GMP at 2.0 A resolution." J Mol Biol 224:1127-1141.1314905