You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAspartyl-tRNA synthetase, mitochondrial
Synonyms
  • Aspartate--tRNA ligase
  • AspRS
Gene NameMSD1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-aspartate + tRNA(Asp) = AMP + diphosphate + L-aspartyl-tRNA(Asp)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Aspartic acid + Adenosine triphosphate + tRNA(Asp) → Adenosine monophosphate + Pyrophosphate + Asp-tRNA(Asp)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
purine nucleoside binding
nucleic acid binding
adenyl nucleotide binding
aspartate-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
nucleoside binding
Process
translation
aspartyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL104W
Gene Sequence>1977 bp ATGTTGGCCCGTTCCAGGGTGTGCTTGCAGACAATCACTAGACGGTTGGCAGACTTTCCA GAAGCCAATGCTATTAAGAAAAAATTTCTCTTTAGGAAGGACACCTCGACCATCAAACAG TTAAAAGGACTGTCTAGCGGCCAGAAAATAGTACTCAATGGATGGATAGAGCAGAAGCCA AAAAGAGTTGGGAAAAATTTGATCTTCGGACTTTTAAGGGACTCTAACGGTGACATTATC CAGTTGGTTGATAACAAATCGTTGTTGAAAGGCTTTACTTTAGAGGATGTGGTTCAAGCC GTAGGTATACTCTCTTTGAAGAGGAAGCTATCAAATGAGGACGCAGATGAGTACGAAGTG CAATTGGAGGATATTACTGTGTTAAATGCATCTAATAAAAAACCAGCGCAAATGCAGGAT TTTAAATTGTCAGCCATATACCCACCTGAGTTCCGCTATTTGCAATTGAGAAATCCCAAA TATCAAGATTTTTTAAAGAAGAGGTCATCTATCTCTAAGGAAATAAGAAACTCCTTCAAC AATTTTGATTTTACGGAGGTCGAGACCCCAATGTTATTTAAAGCTACCCCAGAAGGCGCA AGAGAGTTTCTGGTTCCAACAAGGACAAAGAGATCCGATGGTAAACCATCGTTTTATGCT CTAGATCAGAGCCCTCAACAATACAAGCAACTCTTAATGGCTAGTGGTGTCAACAAATAT TATCAAATGGCAAGGTGCTTTAGAGATGAAGATTTAAGAGCAGACAGGCAGCCTGAGTTT ACACAGGTTGATATGGAAATGGCCTTTGCTAATTCTGAAGATGTCATGAAAATCATAGAA AAGACAGTTTCTGGGGTATGGAGTAAATTTTCCAAAAAACGAGGATTATTGACTTTAGAC AGTAAGGGTACATTAGTGCCTGCGAAAAAGGAAAACGGCACAGTATCTATCTTTCGTATG ACCTACGAACAAGCCATGACCTCATATGGTATTGACAAGCCAGATTTGAGAGCGCCAGAT TTGAAGATTATCAATTTAGGCGAGTTCAATGCCTTTAGTCATTTGAACAAAAAATTTCCC GTTTTTGAAGTAATTATTCTAAGAAGTGCCTTTTCAAATATGGAAGAGTACAAAGAACGA TGGTCGTTTCTGACAAATAACAGTAATTACAATTATAGAGTTCCAATAGTGCTACCAATT GAAAATGACGAACAAGCTAATTCAAATTGGTTTGAGAATTTTCATGCAATTGCCACGTTT GAAAACCCACATCTAATAACCAAATTTCTGAAACTGAAAAAAGGTGACATTGTATGCGGT TGTACGAGAGAGCCAAACCATTCCATTTTCGAGAATCCTACTCCCCTGGGAAGATTGAGA CAGTTGGTGCTACAAAGTGAGCATGGGAAAAATATCTATCATGCTGTCAATAAGGATGTT GCCTCATGGATTGTGGATTTCCCGTTATTTTCTCCCGTTATAATTGAAGATAAGTCTGGT AAAAAAGAAAAGCTTGCATATCCGGAGTACGAAAAGGATAGACTATGTTCCACGCATCAT CCTTTTACTATGGTGAAGCTTAAAGACTACGAAAAATTAGAAAAGACGCCGGAAAAGTGC TTGGGTCGGCATTATGACCTCGTAGTTAACGGTGTGGAACTTGGTGGTGGCTCAACAAGA ATTCACGATCCAAGATTACAAGACTATATTTTCGAAGATATCCTCAAAATAGATAATGCA TATGAACTATTTGGCCATTTACTGAATGCTTTTGATATGGGAACACCGCCACACGCTGGA TTTGCTATTGGTTTTGATCGTATGTGCGCTATGATCTGTGAAACTGAGAGTATAAGGGAC GTAATCGCCTTCCCAAAAAGTATTACCGGGGCTGATTTGGTTGTCAAGAGTCCAAGTGTG ATACCTGAAAGCATTCTGGAACCTTACAATATCAAGTATAGTAATTCAAAAAAATGA
Protein Properties
Pfam Domain Function
Protein Residues658
Protein Molecular Weight75460.0
Protein Theoretical pI9.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aspartyl-tRNA synthetase, mitochondrial MLARSRVCLQTITRRLADFPEANAIKKKFLFRKDTSTIKQLKGLSSGQKIVLNGWIEQKP KRVGKNLIFGLLRDSNGDIIQLVDNKSLLKGFTLEDVVQAVGILSLKRKLSNEDADEYEV QLEDITVLNASNKKPAQMQDFKLSAIYPPEFRYLQLRNPKYQDFLKKRSSISKEIRNSFN NFDFTEVETPMLFKATPEGAREFLVPTRTKRSDGKPSFYALDQSPQQYKQLLMASGVNKY YQMARCFRDEDLRADRQPEFTQVDMEMAFANSEDVMKIIEKTVSGVWSKFSKKRGLLTLD SKGTLVPAKKENGTVSIFRMTYEQAMTSYGIDKPDLRAPDLKIINLGEFNAFSHLNKKFP VFEVIILRSAFSNMEEYKERWSFLTNNSNYNYRVPIVLPIENDEQANSNWFENFHAIATF ENPHLITKFLKLKKGDIVCGCTREPNHSIFENPTPLGRLRQLVLQSEHGKNIYHAVNKDV ASWIVDFPLFSPVIIEDKSGKKEKLAYPEYEKDRLCSTHHPFTMVKLKDYEKLEKTPEKC LGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKIDNAYELFGHLLNAFDMGTPPHAG FAIGFDRMCAMICETESIRDVIAFPKSITGADLVVKSPSVIPESILEPYNIKYSNSKK
References
External Links
ResourceLink
Saccharomyces Genome Database MSD1
Uniprot IDP15179
Uniprot NameSYDM_YEAST
GenBank Gene IDM24418
Genebank Protein ID173036
General Reference
  • Gampel, A., Tzagoloff, A. (1989). "Homology of aspartyl- and lysyl-tRNA synthetases." Proc Natl Acad Sci U S A 86:6023-6027.2668951
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106