Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAspartyl-tRNA synthetase, mitochondrial
Synonyms
  • Aspartate--tRNA ligase
  • AspRS
Gene NameMSD1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-aspartate + tRNA(Asp) = AMP + diphosphate + L-aspartyl-tRNA(Asp)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Aspartic acid + Adenosine triphosphate + tRNA(Asp) → Adenosine monophosphate + Pyrophosphate + Asp-tRNA(Asp)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
nucleic acid binding
adenyl ribonucleotide binding
aspartate-tRNA ligase activity
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
Process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
aspartyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL104W
Gene Sequence>1977 bp ATGTTGGCCCGTTCCAGGGTGTGCTTGCAGACAATCACTAGACGGTTGGCAGACTTTCCA GAAGCCAATGCTATTAAGAAAAAATTTCTCTTTAGGAAGGACACCTCGACCATCAAACAG TTAAAAGGACTGTCTAGCGGCCAGAAAATAGTACTCAATGGATGGATAGAGCAGAAGCCA AAAAGAGTTGGGAAAAATTTGATCTTCGGACTTTTAAGGGACTCTAACGGTGACATTATC CAGTTGGTTGATAACAAATCGTTGTTGAAAGGCTTTACTTTAGAGGATGTGGTTCAAGCC GTAGGTATACTCTCTTTGAAGAGGAAGCTATCAAATGAGGACGCAGATGAGTACGAAGTG CAATTGGAGGATATTACTGTGTTAAATGCATCTAATAAAAAACCAGCGCAAATGCAGGAT TTTAAATTGTCAGCCATATACCCACCTGAGTTCCGCTATTTGCAATTGAGAAATCCCAAA TATCAAGATTTTTTAAAGAAGAGGTCATCTATCTCTAAGGAAATAAGAAACTCCTTCAAC AATTTTGATTTTACGGAGGTCGAGACCCCAATGTTATTTAAAGCTACCCCAGAAGGCGCA AGAGAGTTTCTGGTTCCAACAAGGACAAAGAGATCCGATGGTAAACCATCGTTTTATGCT CTAGATCAGAGCCCTCAACAATACAAGCAACTCTTAATGGCTAGTGGTGTCAACAAATAT TATCAAATGGCAAGGTGCTTTAGAGATGAAGATTTAAGAGCAGACAGGCAGCCTGAGTTT ACACAGGTTGATATGGAAATGGCCTTTGCTAATTCTGAAGATGTCATGAAAATCATAGAA AAGACAGTTTCTGGGGTATGGAGTAAATTTTCCAAAAAACGAGGATTATTGACTTTAGAC AGTAAGGGTACATTAGTGCCTGCGAAAAAGGAAAACGGCACAGTATCTATCTTTCGTATG ACCTACGAACAAGCCATGACCTCATATGGTATTGACAAGCCAGATTTGAGAGCGCCAGAT TTGAAGATTATCAATTTAGGCGAGTTCAATGCCTTTAGTCATTTGAACAAAAAATTTCCC GTTTTTGAAGTAATTATTCTAAGAAGTGCCTTTTCAAATATGGAAGAGTACAAAGAACGA TGGTCGTTTCTGACAAATAACAGTAATTACAATTATAGAGTTCCAATAGTGCTACCAATT GAAAATGACGAACAAGCTAATTCAAATTGGTTTGAGAATTTTCATGCAATTGCCACGTTT GAAAACCCACATCTAATAACCAAATTTCTGAAACTGAAAAAAGGTGACATTGTATGCGGT TGTACGAGAGAGCCAAACCATTCCATTTTCGAGAATCCTACTCCCCTGGGAAGATTGAGA CAGTTGGTGCTACAAAGTGAGCATGGGAAAAATATCTATCATGCTGTCAATAAGGATGTT GCCTCATGGATTGTGGATTTCCCGTTATTTTCTCCCGTTATAATTGAAGATAAGTCTGGT AAAAAAGAAAAGCTTGCATATCCGGAGTACGAAAAGGATAGACTATGTTCCACGCATCAT CCTTTTACTATGGTGAAGCTTAAAGACTACGAAAAATTAGAAAAGACGCCGGAAAAGTGC TTGGGTCGGCATTATGACCTCGTAGTTAACGGTGTGGAACTTGGTGGTGGCTCAACAAGA ATTCACGATCCAAGATTACAAGACTATATTTTCGAAGATATCCTCAAAATAGATAATGCA TATGAACTATTTGGCCATTTACTGAATGCTTTTGATATGGGAACACCGCCACACGCTGGA TTTGCTATTGGTTTTGATCGTATGTGCGCTATGATCTGTGAAACTGAGAGTATAAGGGAC GTAATCGCCTTCCCAAAAAGTATTACCGGGGCTGATTTGGTTGTCAAGAGTCCAAGTGTG ATACCTGAAAGCATTCTGGAACCTTACAATATCAAGTATAGTAATTCAAAAAAATGA
Protein Properties
Pfam Domain Function
Protein Residues658
Protein Molecular Weight75460.0
Protein Theoretical pI9.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aspartyl-tRNA synthetase, mitochondrial MLARSRVCLQTITRRLADFPEANAIKKKFLFRKDTSTIKQLKGLSSGQKIVLNGWIEQKP KRVGKNLIFGLLRDSNGDIIQLVDNKSLLKGFTLEDVVQAVGILSLKRKLSNEDADEYEV QLEDITVLNASNKKPAQMQDFKLSAIYPPEFRYLQLRNPKYQDFLKKRSSISKEIRNSFN NFDFTEVETPMLFKATPEGAREFLVPTRTKRSDGKPSFYALDQSPQQYKQLLMASGVNKY YQMARCFRDEDLRADRQPEFTQVDMEMAFANSEDVMKIIEKTVSGVWSKFSKKRGLLTLD SKGTLVPAKKENGTVSIFRMTYEQAMTSYGIDKPDLRAPDLKIINLGEFNAFSHLNKKFP VFEVIILRSAFSNMEEYKERWSFLTNNSNYNYRVPIVLPIENDEQANSNWFENFHAIATF ENPHLITKFLKLKKGDIVCGCTREPNHSIFENPTPLGRLRQLVLQSEHGKNIYHAVNKDV ASWIVDFPLFSPVIIEDKSGKKEKLAYPEYEKDRLCSTHHPFTMVKLKDYEKLEKTPEKC LGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKIDNAYELFGHLLNAFDMGTPPHAG FAIGFDRMCAMICETESIRDVIAFPKSITGADLVVKSPSVIPESILEPYNIKYSNSKK
References
External Links
ResourceLink
Saccharomyces Genome Database MSD1
Uniprot IDP15179
Uniprot NameSYDM_YEAST
GenBank Gene IDM24418
Genebank Protein ID173036
General Reference
  • Gampel, A., Tzagoloff, A. (1989). "Homology of aspartyl- and lysyl-tRNA synthetases." Proc Natl Acad Sci U S A 86:6023-6027.2668951
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106