You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtein GCY
SynonymsNot Available
Gene NameGCY1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionUnknown function which seems to be not essential
Cellular LocationCytoplasm
SMPDB Pathways
Glycerol metabolismPW002407 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
Dihydroxyacetone + NADPH + hydronNADP + Glycerol
KEGG Reactions
NADP + GlycerolDihydroxyacetone + NADPH + hydron
Metabolites
YMDB IDNameView
YMDB00018DihydroxyacetoneShow
YMDB00283GlycerolShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR120W
Gene Sequence>939 bp ATGCCTGCTACTTTACATGATTCTACGAAAATCCTTTCTCTAAATACTGGAGCCCAAATC CCTCAAATAGGTTTAGGTACGTGGCAGTCGAAAGAGAACGATGCTTATAAGGCTGTTTTA ACCGCTTTGAAAGATGGCTACCGACACATTGATACTGCTGCTATTTACCGTAATGAAGAC CAAGTCGGTCAAGCCATCAAGGATTCAGGTGTTCCTCGGGAAGAAATCTTTGTTACTACA AAGTTATGGTGTACACAACACCACGAACCTGAAGTAGCGCTGGATCAATCACTAAAGAGG TTAGGATTGGACTACGTAGACTTATATTTGATGCATTGGCCTGCCAGATTAGATCCAGCC TACATCAAAAATGAAGACATCTTGAGTGTGCCAACAAAGAAGGATGGTTCTCGTGCAGTG GATATCACCAATTGGAATTTCATCAAAACCTGGGAATTAATGCAGGAACTACCAAAGACT GGTAAAACTAAGGCCGTTGGAGTCTCCAACTTTTCTATAAATAACCTGAAAGATCTATTA GCATCTCAAGGTAATAAGCTTACGCCAGCTGCTAACCAAGTCGAAATACATCCATTACTA CCTCAAGACGAATTGATTAATTTTTGTAAAAGTAAAGGCATTGTGGTTGAAGCTTATTCT CCGTTAGGTAGTACCGATGCTCCACTATTGAAGGAACCGGTTATCCTTGAAATTGCGAAG AAAAATAACGTTCAACCCGGACACGTTGTTATTAGCTGGCACGTCCAAAGAGGTTATGTT GTCTTGCCAAAATCTGTGAATCCCGATCGAATCAAAACGAACAGGAAAATATTTACTTTG TCTACTGAGGACTTTGAAGCTATCAATAACATATCGAAGGAAAAGGGCGAAAAAAGGGTT GTACATCCAAATTGGTCTCCTTTCGAAGTATTCAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues312
Protein Molecular Weight35078.89844
Protein Theoretical pI8.22
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Protein GCY MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV VHPNWSPFEVFK
References
External Links
ResourceLink
Saccharomyces Genome Database GCY1
Uniprot IDP14065
Uniprot NameGCY_YEAST
GenBank Gene IDX13228
Genebank Protein ID3738
General Reference
  • Oechsner, U., Magdolen, V., Bandlow, W. (1988). "A nuclear yeast gene (GCY) encodes a polypeptide with high homology to a vertebrate eye lens protein." FEBS Lett 238:123-128.2901985
  • Angermayr, M., Bandlow, W. (1997). "The type of basal promoter determines the regulated or constitutive mode of transcription in the common control region of the yeast gene pair GCY1/RIO1." J Biol Chem 272:31630-31635.9395503
  • Wiemann, S., Rechmann, S., Benes, V., Voss, H., Schwager, C., Vlcek, C., Stegemann, J., Zimmermann, J., Erfle, H., Paces, V., Ansorge, W. (1996). "Sequencing and analysis of 51 kb on the right arm of chromosome XV from Saccharomyces cerevisiae reveals 30 open reading frames." Yeast 12:281-288.8904341
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956