You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameL-asparaginase 2
Synonyms
  • L-asparaginase II
  • L-asparagine amidohydrolase II
  • ASP II
Gene NameASP3-1
Enzyme Class
Biological Properties
General FunctionInvolved in asparaginase activity
Specific FunctionL-asparagine + H(2)O = L-aspartate + NH(3)
Cellular LocationSecreted, cell wall
SMPDB Pathways
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Cyanoamino acid metabolismec00460 Map00460
Nitrogen metabolismec00910 Map00910
SMPDB ReactionsNot Available
KEGG Reactions
L-Asparagine + water L-Aspartic acid + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00226L-AsparagineShow
YMDB00423AmmoniumShow
YMDB00890waterShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
catalytic activity
asparaginase activity
Process
cellular amino acid metabolic process
aspartate family amino acid metabolic process
asparagine metabolic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR155C
Gene Sequence>1089 bp ATGAGATCTTTAAATACCCTTTTACTTTCTCTCTTTGTCGCAATGTCCAGTGGTGCTCCA CTACTAAAAATTCGTGAAGAGAAGAATTCTCCTTTGCCATCAATCAAAATTTTTGGTACC GGCGGTACTATCGCTTCCAAGGGTTCGACAAGTGCAACAACGGCGGGTTATAGCGTGGGA TTAACCGTAAATGATTTAATAGAAGCCGTCCCATCTTTAGCTGAGAAGGCAAATCTGGAC TATCTTCAAGTGTCTAACGTTGGTTCAAATTCTTTAAACTATACGCATCTGATCCCATTG TATCACGGTATCTCCGAGGCACTAGCCTCTGATGACTACGCTGGTGCGGTTGTCACTCAT GGGACCGACACTATGGAGGAGACAGCTTTCTTCTTAGATTTGACCATAAATTCAGAGAAG CCAGTATGTATCGCAGGCGCTATGCGTCCAGCCACTGCCACGTCTGCTGATGGCCCAATG AATTTATATCAAGCAGTGTCTATTGCTGCTTCTGAGAAATCACTGGGTCGTGGCACGATG ATCACTCTAAACGATCGTATTGCCTCTGGGTTTTGGACAACGAAAATGAATGCCAACTCT TTAGATACATTCAGAGCGGATGAACAGGGATATTTAGGTTACTTTTCAAATGATGACGTG GAGTTTTACTACCCACCAGTCAAGCCAAATGGATGGCAATTTTTTGACATTTCCAACCTC ACAGACCCTTCGGAAATTCCAGAAGTCATTATTCTGTACTCCTATCAAGGCTTGAATCCT GAGCTAATAGTAAAGGCCGTCAAGGACCTGGGCGCAAAAGGTATCGTGTTGGCGGGTTCT GGAGCTGGTTCCTGGACTGCTACGGGTAGTATTGTAAACGAACAACTTTATGAAGAGTAT GGTATACCAATTGTTCACAGCAGAAGAACAGCAGATGGTACAGTTCCTCCAGATGATGCC CCAGAGTACGCCATTGGATCTGGCTACCTAAACCCTCAAAAATCGCGTATTTTGCTACAA TTATGTTTGTACTCCGGCTACGGCATGGATCAGATTAGGTCTGTTTTTTCTGGCGTCTAC GGTGGTTAA
Protein Properties
Pfam Domain Function
Protein Residues362
Protein Molecular Weight38686.19922
Protein Theoretical pI4.44
Signalling Regions
  • 1-25
Transmembrane Regions
  • None
Protein Sequence>L-asparaginase 2 MRSLNTLLLSLFVAMSSGAPLLKIREEKNSSLPSIKIFGTGGTIASKGSTSATTAGYSVG LTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLNYTHLIPLYHGISEALASDDYAGAVVTH GTDTMEETAFFLDLTINSEKPVCIAGAMRPATATSADGPMNLYQAVSIAASEKSLGRGTM ITLNDRIASGFWTTKMNANSLDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNL TDPSEIPEVIILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEY GIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMDQIRSVFSGVY GG
References
External Links
ResourceLink
Saccharomyces Genome Database ASP3-1
Uniprot IDP11163
Uniprot NameASPG2_YEAST
GenBank Gene IDAY557957
Genebank Protein ID45269806
General Reference
  • Kim, K. W., Kamerud, J. Q., Livingston, D. M., Roon, R. J. (1988). "Asparaginase II of Saccharomyces cerevisiae. Characterization of the ASP3 gene." J Biol Chem 263:11948-11953.3042786
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Dunlop, P. C., Meyer, G. M., Ban, D., Roon, R. J. (1978). "Characterization of two forms of asparaginase in Saccharomyces cerevisiae." J Biol Chem 253:1297-1304.342521
  • Dunlop, P. C., Meyer, G. M., Roon, R. J. (1980). "Nitrogen catabolite repression of asparaginase II in Saccharomyces cerevisiae." J Bacteriol 143:422-426.6995441
  • Dunlop, P. C., Meyer, G. M., Roon, R. J. (1980). "Reactions of asparaginase II of Saccharomyces cerevisiae. A mechanistic analysis of hydrolysis and hydroxylaminolysis." J Biol Chem 255:1542-1546.6986375