You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAspartokinase
Synonyms
  • Aspartate kinase
Gene NameHOM3
Enzyme Class
Biological Properties
General FunctionInvolved in amino acid binding
Specific FunctionATP + L-aspartate = ADP + 4-phospho-L- aspartate
Cellular LocationNot Available
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
threonine metabolismPW002401 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Glycine, serine and threonine metabolismec00260 Map00260
Lysine biosynthesisec00300 Map00300
SMPDB Reactions
Adenosine triphosphate + L-Aspartic acidADP + 4-Phospho-L-aspartic acid
L-Aspartic acid + Adenosine triphosphateADP + 4-Phospho-L-aspartic acid
L-aspartic 4-semialdehyde + hydron + NADPHNADP + L-Homoserine
L-aspartic 4-semialdehyde + hydron + NADPHNADP + L-Homoserine
KEGG Reactions
L-Aspartic acid + Adenosine triphosphate4-Phospho-L-aspartic acid + ADP
Metabolites
YMDB IDNameView
YMDB00034L-aspartic 4-semialdehydeShow
YMDB00104L-HomoserineShow
YMDB00109Adenosine triphosphateShow
YMDB001134-Phospho-L-aspartic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
carboxylic acid binding
amino acid binding
catalytic activity
transferase activity
phosphotransferase activity, carboxyl group as acceptor
aspartate kinase activity
transferase activity, transferring phosphorus-containing groups
Process
cellular amino acid metabolic process
cellular amino acid biosynthetic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER052C
Gene Sequence>1584 bp ATGCCAATGGATTTCCAACCTACATCAAGTCATTCGAACTGGGTCGTGCAAAAGTTCGGT GGTACATCTGTCGGTAAATTTCCCGTCCAAATAGTGGATGACATTGTGAAGCACTATTCT AAACCTGACGGCCCAAACAATAATGTCGCTGTCGTTTGTTCCGCCCGTTCTTCATACACC AAGGCTGAAGGTACCACTTCTCGTCTTTTGAAATGTTGTGATTTGGCTTCGCAAGAATCT GAATTTCAAGACATTATCGAAGTTATCAGACAAGACCATATCGATAATGCCGACCGCTTC ATTCTCAATCCTGCCTTGCAAGCCAAGTTAGTGGATGATACCAATAAAGAACTTGAACTG GTCAAGAAATATTTAAATGCTTCAAAAGTTTTGGGTGAAGTGAGTTCACGTACAGTAGAT CTGGTGATGTCATGTGGTGAGAAGTTGAGTTGTTTGTTCATGACTGCTTTATGTAATGAC CGTGGCTGTAAGGCCAAATATGTGGATTTGAGCCACATTGTTCCCTCTGATTTCAGTGCC AGCGCTTTGGATAACAGTTTCTACACTTTCCTGGTTCAAGCATTGAAAGAAAAATTGGCC CCCTTTGTAAGTGCTAAAGAGCGTATCGTTCCAGTCTTTACAGGGTTTTTTGGTTTAGTT CCAACTGGTCTTCTGAATGGTGTTGGTCGTGGCTATACCGATTTATGTGCCGCTTTGATA GCAGTTGCTGTAAATGCTGATGAACTACAAGTTTGGAAGGAAGTTGATGGTATATTTACT GCTGATCCTCGTAAGGTTCCTGAAGCACGTTTGCTAGACAGTGTTACTCCAGAAGAAGCT TCTGAATTAACATATTATGGTTCCGAAGTTATACATCCTTTTACGATGGAACAAGTTATT AGGGCTAAGATTCCTATTAGAATCAAGAATGTTCAAAATCCATTAGGTAACGGTACCATT ATCTACCCAGATAATGTAGCAAAGAAGGGTGAATCTACTCCACCACATCCTCCTGAGAAC TTATCCTCATCTTTCTATGAAAAGAGAAAGAGAGGTGCCACTGCTATCACCACCAAAAAT GACATTTTCGTCATCAACATTCATTCCAATAAGAAAACCCTATCCCATGGTTTCCTAGCT CAAATATTTACCATCCTGGATAAGTACAAGTTAGTCGTAGATTTAATATCTACTTCTGAA GTTCATGTTTCGATGGCTTTGCCCATTCCAGATGCAGACTCATTAAAATCTCTGAGACAA GCTGAGGAAAAATTGAGAATTTTAGGTTCTGTTGATATCACAAAGAAGTTGTCTATTGTT TCATTAGTTGGTAAACATATGAAACAATACATCGGCATTGCTGGTACCATGTTTACTACT CTTGCTGAAGAAGGCATCAACATTGAAATGATTTCTCAAGGGGCAAATGAAATAAACATA TCCTGCGTTATCAATGAATCTGACTCCATAAAAGCGCTACAATGTATTCATGCCAAGTTA CTAAGTGAGCGGACAAATACTTCAAACCAATTTGAACATGCCATTGATGAACGTTTAGAA CAATTGAAAAGACTTGGAATTTAA
Protein Properties
Pfam Domain Function
Protein Residues527
Protein Molecular Weight58109.19922
Protein Theoretical pI6.64
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aspartokinase MPMDFQPTSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYT KAEGTTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELEL VKKYLNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA SALDNSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALI AVAVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVI RAKIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKN DIFVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQ AEEKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINI SCVINESDSIKALQCIHAKLLSERTNTSNQFEHAIDERLEQLKRLGI
References
External Links
ResourceLink
Saccharomyces Genome Database HOM3
Uniprot IDP10869
Uniprot NameAK_YEAST
GenBank Gene IDJ03526
Genebank Protein ID171693
General Reference
  • Rafalski, J. A., Falco, S. C. (1988). "Structure of the yeast HOM3 gene which encodes aspartokinase." J Biol Chem 263:2146-2151.2892836
  • Rafalski, J. A., Falco, S. C. (1990). "Structure of the yeast HOM3 gene which encodes aspartokinase." J Biol Chem 265:15346.2168408
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956