You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c oxidase subunit 7
Synonyms
  • Cytochrome c oxidase polypeptide VII
Gene NameCOX7
Enzyme Class
Biological Properties
General FunctionInvolved in cytochrome-c oxidase activity
Specific Function4 ferrocytochrome c + O(2) + 4 H(+) = 4 ferricytochrome c + 2 H(2)O
Cellular LocationMitochondrion inner membrane
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 13
LocusYMR256C
Gene Sequence>183 bp ATGGCTAATAAAGTTATTCAACTACAGAAAATCTTCCAATCTTCCACTAAACCTCTATGG TGGAGACATCCAAGGTCAGCTTTATACCTGTATCCATTTTATGCTATTTTTGCGGTAGCC GTCGTTACACCACTTCTATACATTCCAAATGCTATTAGAGGTATCAAAGCCAAGAAGGCA TAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues60
Protein Molecular Weight6932.2998
Protein Theoretical pI11.16
Signalling Regions
  • None
Transmembrane Regions
  • 31-51
Protein Sequence>Cytochrome c oxidase subunit 7 MANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA
References
External Links
ResourceLink
Saccharomyces Genome Database COX7
Uniprot IDP10174
Uniprot NameCOX7_YEAST
GenBank Gene IDAY558129
Genebank Protein ID45270148
General Reference
  • Aggeler, R., Capaldi, R. A. (1990). "Yeast cytochrome c oxidase subunit VII is essential for assembly of an active enzyme. Cloning, sequencing, and characterization of the nuclear-encoded gene." J Biol Chem 265:16389-16393.2168889
  • Calder, K. M., McEwen, J. E. (1990). "Nucleotide sequence of the gene encoding cytochrome c oxidase subunit VII from Saccharomyces cerevisiae." Nucleic Acids Res 18:1632.2158084
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Power, S. D., Lochrie, M. A., Poyton, R. O. (1986). "The nuclear-coded subunits of yeast cytochrome c oxidase. The amino acid sequences of subunits VII and VIIa, structural similarities between the three smallest polypeptides of the holoenzyme, and implications for biogenesis." J Biol Chem 261:9206-9209.3013877
  • Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106