Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative formate dehydrogenase 2
Synonyms
  • NAD-dependent formate dehydrogenase 2
Gene NameFDH2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Specific FunctionFormate + NAD(+) = CO(2) + NADH
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Glyoxylate and dicarboxylate metabolismec00630 Map00630
Methane metabolismec00680 Map00680
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00385Formic acidShow
YMDB00412NAD(+)Show
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL275W
Gene Sequence>711 bp ATGGTGGTCATCAATAAGCAATTAATGGTGAGTGGGATATTGCCGGCGTGGCTAAAAAAT GAGTATGATCTGGAAGACAAAATAATTTCAACGGTAGGTGCCGGTAGAATTGGATATAGG GTTCTGGAAAGATTGGTCGCATTTAATCCGAAGAAGTTACTGTACTACGACTACCAGGAA CTACCTGCGGAAGCAATCAATAGATTGAACGAGGCCAGCAAGCTTTTCAATGGCAGAGGT GATATTGTTCAGAGAGTAGAGAAATTGGAGGATATGGTTGCTCAGTCAGATGTTGTTACC ATCAACTGTCCATTGCACAAGGACTCAAGGGGTTTATTCAATAAAAAGCTTATTTCCCAC ATGAAAGATGGTGCATACTTGGTGAATACCGCTAGAGGTGCTATTTGTGTCGCAGAAGAT GTTGCCGAGGCAGTCAAGTCTGGTAAATTGGCTGGCTATGGTGGTGATGTCTGGGATAAG CAACCAGCACCAAAAGACCATCCCTGGAGGACTATGGACAATAAGGACCACGTGGGAAAC GCAATGACTGTTCATATCAGTGGCACATCTCTGCATGCTCAAAAGAGGTACGCTCAGGGA GTAAAGAACATCCTAAATAGTTACTTTTCCAAAAAGTTTGATTACCGTCCACAGGATATT ATTGTGCAGAATGGTTCTTATGCCACCAGAGCTTATGGACAGAAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues236
Protein Molecular Weight26487.19922
Protein Theoretical pI9.71
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative formate dehydrogenase 2 MVVINKQLMVSGILPAWLKNEYDLEDKIISTVGAGRIGYRVLERLVAFNPKKLLYYDYQE LPAEAINRLNEASKLFNGRGDIVQRVEKLEDMVAQSDVVTINCPLHKDSRGLFNKKLISH MKDGAYLVNTARGAICVAEDVAEAVKSGKLAGYGGDVWDKQPAPKDHPWRTMDNKDHVGN AMTVHISGTSLHAQKRYAQGVKNILNSYFSKKFDYRPQDIIVQNGSYATRAYGQKK
References
External Links
ResourceLink
Saccharomyces Genome Database FDH2
Uniprot IDP0CF35
Uniprot NameFDH2_YEAST
GenBank Gene IDZ73632
Genebank Protein ID1370568
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Overkamp, K. M., Kotter, P., van der Hoek, R., Schoondermark-Stolk, S., Luttik, M. A., van Dijken, J. P., Pronk, J. T. (2002). "Functional analysis of structural genes for NAD(+)-dependent formate dehydrogenase in Saccharomyces cerevisiae." Yeast 19:509-520.11921099