Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHomoserine O-acetyltransferase
Synonyms
  • Homoserine O-trans-acetylase
Gene NameMET2
Enzyme Class
Biological Properties
General FunctionInvolved in O-acetyltransferase activity
Specific FunctionAcetyl-CoA + L-homoserine = CoA + O-acetyl-L- homoserine
Cellular LocationNot Available
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Sulfur metabolismec00920 Map00920
SMPDB Reactions
L-Homoserine + Acetyl-CoACoenzyme A + Acetylhomoserine
KEGG Reactions
Acetyl-CoA + L-HomoserineCoenzyme A + O-Acetyl-L-homoserine
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00104L-HomoserineShow
YMDB00158O-Acetyl-L-homoserineShow
YMDB00312Acetyl-CoAShow
YMDB16245AcetylhomoserineShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
homoserine O-acetyltransferase activity
O-acyltransferase activity
O-acetyltransferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
catalytic activity
acyltransferase activity
transferase activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
sulfur amino acid metabolic process
metabolic process
sulfur amino acid biosynthetic process
methionine biosynthetic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL277W
Gene Sequence>1461 bp ATGTCGCATACTTTAAAATCGAAAACGCTCCAAGAGCTGGACATTGAGGAGATTAAGGAA ACTAACCCATTGCTCAAACTAGTTCAAGGGCAGAGGATTGTTCAAGTTCCGGAACTAGTG CTTGAGTCTGGCGTGGTCATAAATAATTTCCCTATTGCTTATAAGACGTGGGGTACACTG AATGAAGCTGGTGATAATGTTCTGGTAATTTGTCATGCCTTGACTGGGTCCGCAGATGTT GCTGACTGGTGGGGCCCTCTTCTGGGTAACGACTTAGCATTCGACCCATCAAGGTTTTTT ATCATATGTTTAAACTCTATGGGCTCTCCATATGGGTCTTTTTCGCCATTAACGATAAAT GAGGAGACGGGCGTTAGATATGGACCCGAATTCCCATTATGTACTGTGCGCGATGACGTT AGAGCTCACAGAATTGTTCTGGATTCTCTGGGAGTAAAGTCAATAGCCTGTGTTATTGGT GGCTCTATGGGGGGGATGCTGAGTTTGGAATGGGCTGCCATGTATGGTAAGGAATATGTG AAGAATATGGTTGCTCTGGCGACATCAGCAAGACATTCTGCCTGGTGCATATCGTGGTCT GAGGCTCAAAGACAATCGATTTACTCAGATCCCAACTACTTGGACGGGTACTATCCGGTA GAGGAGCAACCTGTGGCCGGACTATCGGCTGCACGTATGTCTGCATTGTTGACGTACAGG ACAAGAAACAGTTTCGAGAACAAATTCTCCAGAAGATCTCCTTCAATAGCACAACAACAA AAAGCTCAAAGGGAGGAGACACGCAAACCATCTACTGTCAGCGAACACTCCCTACAAATC CACAATGATGGGTATAAAACAAAAGCCAGCACTGCCATCGCTGGCATTTCTGGGCAAAAA GGTCAAAGCGTGGTGTCCACCGCATCTTCTTCGGATTCATTGAATTCTTCAACATCGATG ACTTCGGTAAGTTCTGTAACGGGTGAAGTGAAGGACATAAAGCCTGCGCAGACGTATTTT TCTGCACAAAGTTACTTGAGGTACCAGGGCACAAAGTTCATCAATAGGTTCGACGCCAAT TGTTACATTGCCATCACACGTAAACTGGATACGCACGATTTGGCAAGAGACAGAGTAGAT GACATCACTGAGGTCCTTTCTACCATCCAACAACCATCCCTGATCATCGGTATCCAATCT GATGGACTGTTCACATATTCAGAACAAGAATTTTTGGCTGAGCACATACCGAAGTCGCAA TTAGAAAAAATTGAATCTCCCGAAGGCCACGATGCCTTCCTATTGGAGTTTAAGCTGATA AACAAACTGATAGTACAATTTTTAAAAACCAACTGCAAGGCCATTACCGATGCCGCTCCA AGAGCTTGGGGAGGTGACGTTGGTAACGATGAAACGAAGACGTCTGTCTTTGGTGAGGCC GAAGAAGTTACCAACTGGTAG
Protein Properties
Pfam Domain Function
Protein Residues486
Protein Molecular Weight53659.0
Protein Theoretical pI5.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Homoserine O-acetyltransferase MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNFPIAYKTWGTL NEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFFIICLNSMGSPYGSFSPLTIN EETGVRYGPEFPLCTVRDDVRAHRIVLDSLGVKSIACVIGGSMGGMLSLEWAAMYGKEYV KNMVALATSARHSAWCISWSEAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYR TRNSFENKFSRRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQGTKFINRFDAN CYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQSDGLFTYSEQEFLAEHIPKSQ LEKIESPEGHDAFLLEFKLINKLIVQFLKTNCKAITDAAPRAWGGDVGNDETKTSVFGEA EEVTNW
References
External Links
ResourceLink
Saccharomyces Genome Database MET2
Uniprot IDP08465
Uniprot NameMET2_YEAST
GenBank Gene IDZ71553
Genebank Protein ID1302344
General Reference
  • Langin, T., Faugeron, G., Goyon, C., Nicolas, A., Rossignol, J. L. (1986). "The MET2 gene of Saccharomyces cerevisiae: molecular cloning and nucleotide sequence." Gene 49:283-293.3552887
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106