You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCDP-diacylglycerol--serine O-phosphatidyltransferase
Synonyms
  • Phosphatidylserine synthase
Gene NameCHO1
Enzyme Class
Biological Properties
General FunctionInvolved in CDP-diacylglycerol-serine O-phosphatidyltransferase activity
Specific FunctionCDP-diacylglycerol + L-serine = CMP + (3-sn- phosphatidyl)-L-serine
Cellular LocationMicrosome. Endoplasmic reticulum. Mitochondrion outer membrane; Peripheral membrane protein
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
Glycine, serine and threonine metabolismec00260 Map00260
SMPDB ReactionsNot Available
KEGG Reactions
L-Serine + CDP-diacylglycerol ↔ Cytidine monophosphate + PC(14:0/16:0) + hydron
Metabolites
YMDB IDNameView
YMDB00112L-SerineShow
YMDB00406Cytidine monophosphateShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
CDP-alcohol phosphatidyltransferase activity
CDP-diacylglycerol-serine O-phosphatidyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, for other substituted phosphate groups
Process
phospholipid metabolic process
phospholipid biosynthetic process
glycerophospholipid metabolic process
CDP-diacylglycerol metabolic process
metabolic process
organophosphate metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER026C
Gene Sequence>831 bp ATGGTTGAATCAGATGAAGATTTCGCACCTCAAGAATTCCCACACACGGACACAGACGTT ATCGTAAATGAACACAGAGACGAAAATGACGGGTATGCCTCAGATGAAGTTGGTGGCACA TTAAGCAGAAGGGCCTCAAGTATATTTTCTATAAATACAACTCCATTGGCCCCCCCTAAT GCTACTGATATCCAAAAATTTACAAGTGACGAACATCATTTCAGCATGATGAGGAATTTG CATATGGCAGATTACATTACTATGCTGAATGGATTTTCTGGGTTTTACTCTATTGTAAGT TGTCTGAGATTTACGCTTACAGGTAAACCTCATTACGTCCAGCGTGCCCATTTCTTTATT TTATTGGCTATGTGTTTCGATTTCCTTGACGGGAGAGTAGCACGTCTGAGAAATAGGTCT TCCTTAATGGGTCAAGAACTGGACTCTTTGGCCGACTTGGTTTCCTTTGGTGTGGCTCCG GCTGCAATTGCTTTTGCCATTGGATTTCAAACTACATTCGATGTCATGATTTTATCTTTC TTTGTCCTTTGCGGCTTAGCGAGATTAGCAACGTTTAATGTCACCGTTGCTCAATTACCC AAAGATTCTAGCACAGGTAAATCTAAATATTTTGAGGGATTGCCTATGCCAACCACTCTA GCTTTGGTGTTGGGTATGGCATATTGTGTCAGAAAGGGTTTAATTTTTGATAACATCCCA TTCGGCATTTTTAGAGAAGACCAAATATTGGAATTTCATCCAATTATTCTAGTATTTTTT ATCCATGGGTGTGGAATGATTTCGAAGAGCTTGAAAATTCCAAAGGCATAG
Protein Properties
Pfam Domain Function
Protein Residues276
Protein Molecular Weight30804.19922
Protein Theoretical pI6.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>CDP-diacylglycerol--serine O-phosphatidyltransferase MVESDEDFAPQEFPHTDTDVIVNEHRDENDGYASDEVGGTLSRRASSIFSINTTPLAPPN ATDIQKFTSDEHHFSMMRNLHMADYITMLNGFSGFYSIVSCLRFTLTGKPHYVQRAHFFI LLGMCFDFLDGRVARLRNRSSLMGQELDSLADLVSFGVAPAAIAFAIGFQTTFDVMILSF FVLCGLARLARFNVTVAQLPKDSSTGKSKYFEGLPMPTTLALVLGMAYCVRKGLIFDNIP FGIFREDQILEFHPIILVFFIHGCGMISKSLKIPKP
References
External Links
ResourceLink
Saccharomyces Genome Database CHO1
Uniprot IDP08456
Uniprot NamePSS_YEAST
GenBank Gene IDD00171
Genebank Protein ID218415
General Reference
  • Nikawa, J., Tsukagoshi, Y., Kodaki, T., Yamashita, S. (1987). "Nucleotide sequence and characterization of the yeast PSS gene encoding phosphatidylserine synthase." Eur J Biochem 167:7-12.3040403
  • Kiyono, K., Miura, K., Kushima, Y., Hikiji, T., Fukushima, M., Shibuya, I., Ohta, A. (1987). "Primary structure and product characterization of the Saccharomyces cerevisiae CHO1 gene that encodes phosphatidylserine synthase." J Biochem 102:1089-1100.2830250
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956