You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameChitin synthase 1
Synonyms
  • Chitin-UDP acetyl-glucosaminyl transferase 1
Gene NameCHS1
Enzyme Class
Biological Properties
General FunctionInvolved in chitin synthase activity
Specific FunctionSeptum formation and repair, especially under certain adverse conditions
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB Reactions
Uridine diphosphate-N-acetylglucosamine + ChitinUridine 5'-diphosphate + Chitin
KEGG Reactions
Uridine diphosphate-N-acetylglucosamine → chitin + Uridine 5'-diphosphate + hydron
Metabolites
YMDB IDNameView
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00862hydronShow
YMDB16156ChitinShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
UDP-glycosyltransferase activity
acetylglucosaminyltransferase activity
chitin synthase activity
Process
aminoglycan biosynthetic process
chitin biosynthetic process
metabolic process
primary metabolic process
carbohydrate metabolic process
polysaccharide metabolic process
polysaccharide biosynthetic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL192W
Gene Sequence>3396 bp ATGAGTGATCAAAATAATCGATCGAGAAATGAATATCACTCAAACCGGAAGAATGAACCT TCCTATGAACTCCAAAATGCACATAGCGGGCTATTTCACTCTTCTAATGAAGAATTAACA AACAGGAACCAAAGATATACCAATCAAAATGCCAGCATGGGTTCATTCACTCCAGTCCAA TCTTTGCAATTTCCAGAACAATCTCAGCAAACAAATATGCTTTATAACGGTGACGATGGC AATAATAATACTATCAATGATAACGAACGAGACATATATGGAGGTTTTGTCAACCACCAT CGCCAGCGTCCCCCACCAGCAACTGCAGAATACAATGACGTTTTTAATACGAATAGTCAA CAGCTACCGTCGGAACATCAATACAATAACGTACCTTCATATCCACTTCCTTCGATAAAT GTGATTCAAACCACTCCAGAACTCATACATAACGGCTCACAGACTATGGCCACCCCCATC GAAAGGCCCTTCTTTAACGAAAACGACTACTATTATAATAACAGGAACTCTAGGACGTCA CCGAGTATTGCTTCTAGTAGCGATGGTTATGCAGATCAGGAAGCTAGGCCCATTTTGGAG CAACCCAACAATAACATGAATAGCGGTAATATTCCTCAATACCATGACCAACCTTTTGGA TACAACAATGGTTACCATGGCCTACAGGCAAAAGATTACTATGACGATCCGGAGGGTGGT TATATTGATCAGAGAGGAGATGACTATCAGATTAATTCATATTTGGGTAGAAACGGTGAA ATGGTTGATCCTTACGATTATGAAAACAGTTTAAGACATATGACTCCTATGGAGCGTAGA GAATATCTTCATGATGATAGCAGACCCGTAAACGATGGAAAAGAAGAATTAGACAGTGTG AAAAGCGGTTACTCTCATAGAGACTTGGGGGAATATGACAAGGATGATTTTTCAAGGGAT GACGAGTACGATGATCTCAACACTATTGATAAATTACAGTTTCAAGCTAATGGTGTACCT GCATCATCCTCGGTGTCTTCTATCGGATCTAAAGAATCCGACATAATAGTAAGCAATGAT AACTTAACCGCAAATAGAGCACTAAAGAGAAGCGGTACTGAAATTAGGAAATTCAAACTT TGGAATGGTAATTTTGTTTTCGATTCTCCAATCAGTAAGACGCTATTGGACCAATACGCT ACTACAACAGAAAATGCAAACACTTTACCAAATGAGTTTAAGTTTATGAGATATCAAGCA GTTACTTGCGAACCTAATCAACTTGCAGAGAAGAATTTCACGGTGAGGCAGTTGAAGTAT TTAACTCCAAGGGAAACGGAATTGATGCTAGTAGTCACAATGTATAATGAAGACCATATC CTGTTAGGAAGAACTTTGAAAGGTATTATGGACAATGTCAAATATATGGTGAAAAAAAAA AATTCAAGCACTTGGGGGCCGGATGCATGGAAAAAGATTGTCGTTTGTATCATTTCAGAT GGTAGATCCAAAATTAATGAACGCTCGCTAGCATTACTAAGTTCGTTAGGTTGTTACCAG GACGGGTTTGCTAAGGATGAAATTAATGAAAAAAAAGTGGCAATGCATGTCTACGAACAT ACGACAATGATCAACATCACAAATATTTCGGAATCAGAGGTTTCATTAGAATGCAATCAA GGTACCGTTCCAATACAACTTTTGTTTTGTTTGAAAGAGCAAAATCAGAAAAAAATTAAC TCACATAGATGGGCATTTGAAGGCTTTGCAGAATTACTGCGTCCCAATATCGTTACATTG TTAGATGCTGGTACCATGCCAGGTAAAGATTCTATTTACCAGTTATGGAGAGAGTTCAGG AATCCAAATGTTGGTGGCGCATGTGGTGAAATAAGAACTGATTTGGGTAAGAGATTTGTA AAGCTTTTGAATCCTTTAGTTGCATCACAGAATTTCGAATACAAAATGTCCAATATTTTA GACAAAACAACCGAGTCTAACTTTGGATTTATTACTGTTCTACCGGGGGCATTCTCTGCG TATAGGTTTGAAGCTGTGAGAGGCCAACCATTACAGAAGTACTTTTATGGTGAAATTATG GAAAATGAAGGCTTTCATTTTTTTTCTTCCAATATGTATCTTGCTGAAGATCGTATTTTA TGCTTTGAAGTGGTCACAAAAAAAAATTGTAATTGGATTTTGAAATACTGCAGAAGTTCT TATGCTTCAACAGATGTACCGGAGAGGGTCCCTGAATTTATTCTTCAGAGGAGGCGTTGG TTGAATGGTTCATTTTTTGCTAGTGTATATTCCTTTTGTCATTTTTACAGAGTCTGGAGC AGTGGTCATAATATTGGTAGAAAACTCCTTTTGACGGTTGAATTTTTTTACCTTTTCTTC AATACATTGATTTCATGGTTTTCATTGAGTTCATTTTTCCTATTCTTTAGAATTCTCACT GTTTCTATTGCACTGGCATACCATTCAGCATTTAATGTGTTGTCCGTCATATTCCTGTGG CTTTATGGGATTTGTACCTTATCAACATTCATACTGTCATTGGGTAATAAACCTAAAAGT ACTGAGAAATTTTATGTTCTAACTTGCGTCATTTTTGCGGTGATGATGATTTACATGATA TTCTGCAGTATATTCATGAGTGTCAAATCCTTCCAAAATATATTGAAAAACGATACCATC AGCTTTGAGGGTTTGATTACCACAGAAGCTTTCAGGGATATTGTTATCTCTCTGGGCTCC ACTTATTGTTTGTACCTAATCAGTTCAATTATCTATTTGCAGCCATGGCATATGTTGACA AGTTTTATTCAGTATATTTTATTGAGTCCTTCTTACATCAATGTTTTGAATATCTATGCA TTTTGTAATGTCCACGACTTATCATGGGGTACAAAGGGTGCAATGGCAAATCCGCTGGGT AAGATTAATACTACAGAAGATGGTACGTTCAAAATGGAAGTTCTGGTCTCTAGTTCAGAG ATTCAAGCAAACTACGATAAATATTTGAAAGTTTTAAATGACTTCGATCCAAAATCAGAA TCTCGGCCTACTGAGCCATCTTATGATGAAAAAAAGACTGGCTATTATGCAAACGTTAGA TCTCTCGTGATTATCTTTTGGGTCATCACAAATTTCATCATCGTTGCTGTTGTCTTAGAA ACCGGTGGGATTGCAGATTATATTGCTATGAAATCCATATCAACTGATGACACTTTAGAA ACTGCAAAGAAGGCGGAAATTCCCTTAATGACCAGTAAGGCCTCAATTTATTTTAATGTA ATTTTATGGTTAGTTGCATTATCGGCATTAATAAGGTTCATTGGTTGCTCAATATACATG ATAGTAAGGTTTTTTAAAAAGGTTACATTTCGCTAA
Protein Properties
Pfam Domain Function
Protein Residues1131
Protein Molecular Weight129918.0
Protein Theoretical pI6.15
Signalling Regions
  • None
Transmembrane Regions
  • 795-815
  • 833-853
  • 866-886
  • 914-934
  • 942-962
  • 1042-1062
  • 1101-1121
Protein Sequence>Chitin synthase 1 MSDQNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQ SLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQ QLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTS PSIASSSDGYADQEARPILEQPNNNMNSGNIPQYHDQPFGYNNGYHGLQAKDYYDDPEGG YIDQRGDDYQINSYLGRNGEMVDPYDYENSLRHMTPMERREYLHDDSRPVNDGKEELDSV KSGYSHRDLGEYDKDDFSRDDEYDDLNTIDKLQFQANGVPASSSVSSIGSKESDIIVSND NLTANRALKRSGTEIRKFKLWNGNFVFDSPISKTLLDQYATTTENANTLPNEFKFMRYQA VTCEPNQLAEKNFTVRQLKYLTPRETELMLVVTMYNEDHILLGRTLKGIMDNVKYMVKKK NSSTWGPDAWKKIVVCIISDGRSKINERSLALLSSLGCYQDGFAKDEINEKKVAMHVYEH TTMINITNISESEVSLECNQGTVPIQLLFCLKEQNQKKINSHRWAFEGFAELLRPNIVTL LDAGTMPGKDSIYQLWREFRNPNVGGACGEIRTDLGKRFVKLLNPLVASQNFEYKMSNIL DKTTESNFGFITVLPGAFSAYRFEAVRGQPLQKYFYGEIMENEGFHFFSSNMYLAEDRIL CFEVVTKKNCNWILKYCRSSYASTDVPERVPEFILQRRRWLNGSFFASVYSFCHFYRVWS SGHNIGRKLLLTVEFFYLFFNTLISWFSLSSFFLFFRILTVSIALAYHSAFNVLSVIFLW LYGICTLSTFILSLGNKPKSTEKFYVLTCVIFAVMMIYMIFCSIFMSVKSFQNILKNDTI SFEGLITTEAFRDIVISLGSTYCLYLISSIIYLQPWHMLTSFIQYILLSPSYINVLNIYA FCNVHDLSWGTKGAMANPLGKINTTEDGTFKMEVLVSSSEIQANYDKYLKVLNDFDPKSE SRPTEPSYDEKKTGYYANVRSLVIIFWVITNFIIVAVVLETGGIADYIAMKSISTDDTLE TAKKAEIPLMTSKASIYFNVILWLVALSALIRFIGCSIYMIVRFFKKVTFR
References
External Links
ResourceLink
Saccharomyces Genome Database CHS1
Uniprot IDP08004
Uniprot NameCHS1_YEAST
GenBank Gene IDM14045
Genebank Protein ID171215
General Reference
  • Bulawa, C. E., Slater, M., Cabib, E., Au-Young, J., Sburlati, A., Adair, W. L. Jr, Robbins, P. W. (1986). "The S. cerevisiae structural gene for chitin synthase is not required for chitin synthesis in vivo." Cell 46:213-225.2941152
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956