You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydrofolate reductase
SynonymsNot Available
Gene NameDFR1
Enzyme Class
Biological Properties
General FunctionInvolved in dihydrofolate reductase activity
Specific FunctionKey enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis
Cellular LocationNot Available
SMPDB Pathways
tetrahydrofolate biosynthesisPW002417 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Folate biosynthesisec00790 Map00790
One carbon pool by folateec00670 Map00670
SMPDB Reactions
7,8-dihydrofolate monoglutamate + hydron + NADPHNADP + Tetrahydrofolic acid
Dihydrofolic acid + NADPFolic acid + NADPH + hydron
Dihydrofolic acid + NADPH + hydronTetrahydrofolic acid + NADP
Folic acid + NADPH + hydronTetrahydrofolic acid + NADP
KEGG Reactions
NADPH + hydron + Dihydrofolic acidNADP + 5,6,7,8-Tetrahydrofolic acid
Metabolites
YMDB IDNameView
YMDB00079Dihydrofolic acidShow
YMDB00139Tetrahydrofolic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB00862hydronShow
YMDB16112Folic acidShow
YMDB162807,8-dihydrofolate monoglutamateShow
GO Classification
Component
Not Available
Function
binding
nucleotide binding
oxidoreductase activity
catalytic activity
NADP or NADPH binding
oxidoreductase activity, acting on the CH-NH group of donors
oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
dihydrofolate reductase activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
oxidation reduction
serine family amino acid metabolic process
metabolic process
glycine metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleotide biosynthetic process
nucleoside phosphate metabolic process
glycine biosynthetic process
nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR236W
Gene Sequence>636 bp ATGGCTGGAGGAAAGATTCCTATTGTAGGAATTGTGGCATGTTTACAGCCGGAGATGGGG ATAGGATTTCGTGGAGGTCTACCATGGAGGTTGCCCAGTGAAATGAAGTATTTCAGACAG GTCACTTCATTGACGAAAGATCCAAACAAAAAAAATGCTTTGATAATGGGAAGGAAGACA TGGGAATCCATACCGCCCAAGTTTCGCCCACTGCCCAATAGAATGAATGTCATTATATCG AGAAGCTTCAAGGACGATTTTGTCCACGATAAAGAGAGATCAATAGTCCAAAGTAATTCA TTGGCAAACGCAATAATGAACCTAGAAAGCAATTTTAAGGAGCATCTGGAAAGAATCTAC GTGATTGGGGGTGGCGAAGTTTATAGTCAAATCTTCTCCATTACAGATCATTGGCTCATC ACGAAAATAAATCCATTAGATAAAAACGCAACTCCTGCAATGGACACTTTCCTTGATGCG AAGAAATTGGAAGAAGTATTTAGCGAGCAAGATCCGGCCCAGCTGAAAGAATTTCTTCCC CCTAAAGTAGAGTTGCCCGAAACAGACTGTGATCAACGCTACTCGCTGGAAGAAAAAGGT TATTGCTTCGAATTCACTCTATACAATCGTAAATGA
Protein Properties
Pfam Domain Function
Protein Residues211
Protein Molecular Weight24260.80078
Protein Theoretical pI8.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dihydrofolate reductase MAGGKIPIVGIVACLQPEMGIGFRGGLPWRLPSEMKYFRQVTSLTKDPNKKNALIMGRKT WESIPPKFRPLPNRMNVIISRSFKDDFVHDKERSIVQSNSLANAIMNLESNFKEHLERIY VIGGGEVYSQIFSITDHWLITKINPLDKNATPAMDTFLDAKKLEEVFSEQDPAQLKEFLP PKVELPETDCDQRYSLEEKGYCFEFTLYNRK
References
External Links
ResourceLink
Saccharomyces Genome Database DFR1
Uniprot IDP07807
Uniprot NameDYR_YEAST
GenBank Gene IDM18578
Genebank Protein ID171397
General Reference
  • Lagosky, P. A., Taylor, G. R., Haynes, R. H. (1987). "Molecular characterization of the Saccharomyces cerevisiae dihydrofolate reductase gene (DFR1)." Nucleic Acids Res 15:10355-10371.2827121
  • Fling, M. E., Kopf, J., Richards, C. A. (1988). "Nucleotide sequence of the dihydrofolate reductase gene of Saccharomyces cerevisiae." Gene 63:165-174.2838385
  • Boyer, J., Michaux, G., Fairhead, C., Gaillon, L., Dujon, B. (1996). "Sequence and analysis of a 26.9 kb fragment from chromosome XV of the yeast Saccharomyces cerevisiae." Yeast 12:1575-1586.8972580
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Barclay, B. J., Huang, T., Nagel, M. G., Misener, V. L., Game, J. C., Wahl, G. M. (1988). "Mapping and sequencing of the dihydrofolate reductase gene (DFR1) of Saccharomyces cerevisiae." Gene 63:175-185.2838386
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106