You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSeryl-tRNA synthetase, cytoplasmic
Synonyms
  • Serine--tRNA ligase
  • SerRS
  • Seryl-tRNA(Ser/Sec) synthetase
Gene NameSES1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionCatalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec)
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Serine + Adenosine triphosphate + tRNA(Ser) → Adenosine monophosphate + Ser-tRNA(Ser) + Pyrophosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00112L-SerineShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
nucleotide binding
ligase activity
binding
nucleoside binding
purine nucleoside binding
serine-tRNA ligase activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
seryl-tRNA aminoacylation
Gene Properties
Chromosome Locationchromosome 4
LocusYDR023W
Gene Sequence>1389 bp ATGTTGGACATCAACCAATTTATCGAAGATAAGGGTGGTAACCCAGAGCTAATCAGACAA TCTCAGAAAGCAAGAAATGCCAGTGTTGAAATCGTCGATGAAATTATTTCCGACTACAAA GATTGGGTCAAAACAAGATTCGAATTAGATGAATTGAACAAGAAATTCAACAAGCTTCAA AAGGATATTGGTTTGAAGTTTAAAAACAAGGAAGACGCTTCCGGATTATTAGCCGAAAAA GAGAAGTTAACCCAACAAAAGAAGGAATTGACTGAAAAGGAGCAACAGGAAGATAAGGAC TTGAAGAAAAAAGTTTTTCAAGTAGGAAATATCGTTCATCCATCTGTTGTTGTTTCCAAC GATGAAGAAAACAATGAATTGGTCCGTACTTGGAAACCAGAGGATTTAGAAGCGGTTGGC CCCATTGCTTCTGTGACTGGTAAACCAGCTAGTTTATCCCATCATGAAATCTTGCTAAGA TTAGATGGATATGATCCAGACCGTGGTGTAAAGATTTGTGGTCATAGAGGTTATTTCTTC AGAAATTATGGTGTTTTCTTGAACCAAGCTTTGATTAACTATGGTTTACAGTTCTTAGCT GCCAAGGGTTATATTCCTTTACAAGCTCCAGTCATGATGAATAAAGAACTTATGTCAAAA ACTGCTCAACCATCTGAATTCGATGAAGAGTTATACAAAGTTATCGATGGTGAAGATGAA AAATACCTAATTGCTACCTCAGAACAACCTATCTCCGCTTACCACAGCGGTGAATGGTTT GAAAAGCCACAAGAGCAATTGCCAATTCACTATGTCGGTTACTCCTCTTGTTTCCGTAGA GAAGCCGGTTCTCACGGTAAGGATGCTTGGGGTGTCTTCAGAGTTCATGCTTTCGAAAAA ATTGAACAATTCGTCATCACTGAACCTGAAAAATCTTGGGAGGAGTTTGAAAAGATGATC TCTTACTCTGAGGAATTTTATAAGTCTTTGAAATTACCATACCGTATCGTTGGTATCGTT TCCGGTGAATTAAACAATGCTGCCGCTAAAAAGTACGATTTAGAAGCCTGGTTCCCATAC CAAAAGGAGTACAAAGAACTCGTCTCTTGCTCCAATTGTACTGATTATCAGTCAAGAAAC TTAGAAATTAGATGCGGTATAAAGAAAATGGGCGACAGAGAAAAGAAATACGTACACTGT TTGAATTCCACTTTGGCTGCTACCCAAAGAGCTTTGTGCTGTATCTTGGAGAACTACCAA ACGGAAGATGGTTTGGTTGTACCAGAAGTTTTGAGGAAATACATTCCAGGTGAACCAGAA TTTTTACCATTCGTTAATGAATTACCAAAGAATTCCACCTCTAGTAAAGACAAGAAAAAG AAGAATTAA
Protein Properties
Pfam Domain Function
Protein Residues462
Protein Molecular Weight53309.19922
Protein Theoretical pI5.94
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Seryl-tRNA synthetase, cytoplasmic MLDINQFIEDKGGNPELIRQSQKARNASVEIVDEIISDYKDWVKTRFELDELNKKFNKLQ KDIGLKFKNKEDASGLLAEKEKLTQQKKELTEKEQQEDKDLKKKVFQVGNIVHPSVVVSN DEENNELVRTWKPEDLEAVGPIASVTGKPASLSHHEILLRLDGYDPDRGVKICGHRGYFF RNYGVFLNQALINYGLQFLAAKGYIPLQAPVMMNKELMSKTAQLSEFDEELYKVIDGEDE KYLIATSEQPISAYHSGEWFEKPQEQLPIHYVGYSSCFRREAGSHGKDAWGVFRVHAFEK IEQFVITEPEKSWEEFEKMISYSEEFYKSLKLPYRIVGIVSGELNNAAAKKYDLEAWFPY QKEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVHCLNSTLAATQRALCCILENYQ TEDGLVVPEVLRKYIPGEPEFLPFVNELPKNSTSSKDKKKKN
References
External Links
ResourceLink
Saccharomyces Genome Database SES1
Uniprot IDP07284
Uniprot NameSYSC_YEAST
GenBank Gene IDX04884
Genebank Protein ID4458
General Reference
  • Weygand-Durasevic, I., Johnson-Burke, D., Soll, D. (1987). "Cloning and characterization of the gene coding for cytoplasmic seryl-tRNA synthetase from Saccharomyces cerevisiae." Nucleic Acids Res 15:1887-1904.3031581
  • Eide, L. G., Sander, C., Prydz, H. (1996). "Sequencing and analysis of a 35.4 kb region on the right [corrected] arm of chromosome IV from Saccharomyces cerevisiae reveal 23 open reading frames." Yeast 12:1085-1090.8896275
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Folley, L. S., Fox, T. D. (1994). "Reduced dosage of genes encoding ribosomal protein S18 suppresses a mitochondrial initiation codon mutation in Saccharomyces cerevisiae." Genetics 137:369-379.8070651
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956