Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtein MET17
Synonyms
  • O-acetylhomoserine sulfhydrylase
  • OAH sulfhydrylase
  • Homocysteine synthase
  • O-acetylserine sulfhydrylase
  • OAS sulfhydrylase
Gene NameMET17
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal phosphate binding
Specific FunctionTransforms O-acetylhomoserine into homocysteine and O- acetylserine into cysteine
Cellular LocationCytoplasm
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Acetylhomoserine + Hydrogen sulfideAcetic acid + hydron + Homocysteine
KEGG Reactions
Methanethiol + O-Acetyl-L-homoserineL-Methionine + Acetic acid + hydron
O-Acetyl-L-homoserine + Hydrogen sulfideL-Homocysteine + Acetic acid + hydron
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00056Acetic acidShow
YMDB00062MethanethiolShow
YMDB00121SulfideShow
YMDB00158O-Acetyl-L-homoserineShow
YMDB00318L-MethionineShow
YMDB00371HomocysteineShow
YMDB00520L-HomocysteineShow
YMDB00652O-acetyl-L-serineShow
YMDB00653Hydrogen sulfideShow
YMDB00862hydronShow
YMDB16245AcetylhomoserineShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
pyridoxal phosphate binding
transferase activity, transferring alkyl or aryl (other than methyl) groups
catalytic activity
transferase activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR303W
Gene Sequence>1335 bp ATGCCATCTCATTTCGATACTGTTCAACTACACGCCGGCCAAGAGAACCCTGGTGACAAT GCTCACAGATCCAGAGCTGTACCAATTTACGCCACCACTTCTTATGTTTTCGAAAACTCT AAGCATGGTTCGCAATTGTTTGGTCTAGAAGTTCCAGGTTACGTCTATTCCCGTTTCCAA AACCCAACCAGTAATGTTTTGGAAGAAAGAATTGCTGCTTTAGAAGGTGGTGCTGCTGCT TTGGCTGTTTCCTCCGGTCAAGCCGCTCAAACCCTTGCCATCCAAGGTTTGGCACACACT GGTGACAACATCGTTTCCACTTCTTACTTATACGGTGGTACTTATAACCAGTTCAAAATC TCGTTCAAAAGATTTGGTATCGAGGCTAGATTTGTTGAAGGTGACAATCCAGAAGAATTC GAAAAGGTCTTTGATGAAAGAACCAAGGCTGTTTATTTGGAAACCATTGGTAATCCAAAG TACAATGTTCCGGATTTTGAAAAAATTGTTGCAATTGCTCACAAACACGGTATTCCAGTT GTCGTTGACAACACATTTGGTGCCGGTGGTTACTTCTGTCAGCCAATTAAATACGGTGCT GATATTGTAACACATTCTGCTACCAAATGGATTGGTGGTCATGGTACTACTATCGGTGGT ATTATTGTTGACTCTGGTAAGTTCCCATGGAAGGACTACCCAGAAAAGTTCCCTCAATTC TCTCAACCTGCCGAAGGATATCACGGTACTATCTACAATGAAGCCTACGGTAACTTGGCA TACATCGTTCATGTTAGAACTGAACTATTAAGAGATTTGGGTCCATTGATGAACCCATTT GCCTCTTTCTTGCTACTACAAGGTGTTGAAACATTATCTTTGAGAGCTGAAAGACACGGT GAAAATGCATTGAAGTTAGCCAAATGGTTAGAACAATCCCCATACGTATCTTGGGTTTCA TACCCTGGTTTAGCATCTCATTCTCATCATGAAAATGCTAAGAAGTATCTATCTAACGGT TTCGGTGGTGTCTTATCTTTCGGTGTAAAAGACTTACCAAATGCCGACAAGGAAACTGAC CCATTCAAACTTTCTGGTGCTCAAGTTGTTGACAATTTAAAGCTTGCCTCTAACTTGGCC AATGTTGGTGATGCCAAGACCTTAGTCATTGCTCCATACTTCACTACCCACAAACAATTA AATGACAAAGAAAAGTTGGCATCTGGTGTTACCAAGGACTTAATTCGTGTCTCTGTTGGT ATCGAATTTATTGATGACATTATTGCAGACTTCCAGCAATCTTTTGAAACGGTTTTCGCT GGCCAAAAACCATGA
Protein Properties
Pfam Domain Function
Protein Residues444
Protein Molecular Weight48671.39844
Protein Theoretical pI6.41
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Protein MET17 MPSHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQ NPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKI SFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPV VVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQF SQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHG ENALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETD PFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVG IEFIDDIIADFQQSFETVFAGQKP
References
External Links
ResourceLink
Saccharomyces Genome Database MET17
Uniprot IDP06106
Uniprot NameMET17_YEAST
GenBank Gene IDAY723848
Genebank Protein ID51830472
General Reference
  • Kerjan, P., Cherest, H., Surdin-Kerjan, Y. (1986). "Nucleotide sequence of the Saccharomyces cerevisiae MET25 gene." Nucleic Acids Res 14:7861-7871.3022238
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ono, B., Ishii, N., Naito, K., Miyoshi, S., Shinoda, S., Yamamoto, S., Ohmori, S. (1993). "Cystathionine gamma-lyase of Saccharomyces cerevisiae: structural gene and cystathionine gamma-synthase activity." Yeast 9:389-397.8511969
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956