You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameADP,ATP carrier protein 1
Synonyms
  • ADP/ATP translocase 1
  • Adenine nucleotide translocator 1
  • ANT 1
Gene NameAAC1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transporter activity
Specific FunctionCatalyzes the exchange of ADP and ATP across the mitochondrial inner membrane
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
mitochondrial inner membrane
cell part
membrane
organelle membrane
organelle inner membrane
Function
binding
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 13
LocusYMR056C
Gene Sequence>930 bp ATGTCTCACACAGAAACACAGACTCAGCAGTCACACTTCGGTGTGGACTTCCTTATGGGC GGCGTTTCTGCTGCCATTGCGAAGACGGGTGCCGCTCCCATTGAACGGGTGAAACTGTTG ATGCAGAATCAAGAAGAGATGCTTAAACAGGGCTCGTTGGATACACGGTACAAGGGAATT TTAGATTGCTTCAAGAGGACTGCGACTCATGAAGGTATTGTGTCGTTCTGGAGGGGTAAC ACCGCCAATGTTCTCCGGTATTTCCCCACGCAGGCGCTGAATTTTGCCTTCAAAGACAAA ATTAAGTCGTTGTTGAGTTACGACAGAGAGCGCGATGGGTATGCCAAGTGGTTTGCTGGA AATCTTTTCTCTGGTGGAGCGGCTGGTGGTTTGTCGCTTCTATTTGTATATTCCTTGGAC TACGCAAGGACGCGGCTTGCAGCGGATGCTAGGGGTTCTAAGTCAACCTCGCAAAGACAG TTTAATGGATTGCTAGACGTGTATAAGAAGACACTGAAAACGGACGGGTTGTTGGGTCTG TACCGTGGGTTTGTGCCCTCAGTTCTGGGTATCATTGTCTACAGAGGTCTGTACTTTGGC TTGTACGATTCTTTCAAGCCTGTGCTGTTGACGGGGGCTCTAGAGGGGTCCTTTGTTGCC TCTTTCCTATTAGGTTGGGTCATTACCATGGGTGCTTCCACTGCGTCGTATCCCTTGGAT ACGGTAAGAAGAAGGATGATGATGACTTCGGGCCAGACCATCAAGTACGACGGTGCTCTG GACTGTTTGAGAAAGATTGTTCAGAAAGAGGGCGCGTATTCCTTGTTCAAGGGCTGTGGT GCCAACATATTTAGAGGAGTCGCTGCAGCTGGTGTCATCTCATTGTACGATCAGTTGCAA CTCATAATGTTTGGCAAAAAATTCAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues309
Protein Molecular Weight34120.19922
Protein Theoretical pI10.16
Signalling Regions
  • None
Transmembrane Regions
  • 10-44
  • 81-105
  • 114-148
  • 183-210
  • 215-249
  • 278-303
Protein Sequence>ADP,ATP carrier protein 1 MSHTETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGI LDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAG NLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGL YRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGASTASYPLD TVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISLYDQLQ LIMFGKKFK
References
External Links
ResourceLink
Saccharomyces Genome Database AAC1
Uniprot IDP04710
Uniprot NameADT1_YEAST
GenBank Gene IDM12514
Genebank Protein ID172134
General Reference
  • Adrian, G. S., McCammon, M. T., Montgomery, D. L., Douglas, M. G. (1986). "Sequences required for delivery and localization of the ADP/ATP translocator to the mitochondrial inner membrane." Mol Cell Biol 6:626-634.3023860
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hoyt, M. A., Totis, L., Roberts, B. T. (1991). "S. cerevisiae genes required for cell cycle arrest in response to loss of microtubule function." Cell 66:507-517.1651171