You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUbiquinone biosynthesis protein COQ4, mitochondrial
Synonyms
  • Coenzyme Q biosynthesis protein 4
Gene NameCOQ4
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in ubiquinone biosynthetic process
Specific FunctionComponent of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of COQ3, COQ4, COQ6, COQ7 and COQ9 polypeptides
Cellular LocationMitochondrion inner membrane; Peripheral membrane protein; Matrix side
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB001742-Hexaprenyl-6-methoxy-1,4-benzoquinoneShow
YMDB00198S-AdenosylhomocysteineShow
YMDB00412NAD(+)Show
YMDB004372-hexaprenyl-6-methoxy-3-methyl-1,4-benzoquinoneShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB004402-hexaprenyl-6-methoxyphenolShow
YMDB004603-Hexaprenyl-4,5-dihydroxybenzoic acidShow
YMDB004613-Hexaprenyl-4-hydroxy-5-methoxybenzoic acidShow
YMDB007012-hexaprenyl-5-hydroxy-6-methoxy-3-methyl-1,4-benzoquinoneShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB00915Ubiquinol-6Show
GO Classification
Component
Not Available
Function
Not Available
Process
ubiquinone biosynthetic process
metabolic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
oxidoreduction coenzyme metabolic process
ubiquinone metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR204W
Gene Sequence>1008 bp ATGTTGAGGTTATCTTTACTGAGATCAACAGCTACTTTGCCAGTGAAATGCCAACGTCGT GGGCTAATATTACCTGCGGCGGCAATGTACACCTTAGGCTCATTAATATTTGGTAAGGAA GCAAGGTTGGCGGATGCCATGGAACGTGGTGAGTTACATAACAAGAACGTTGATTATGCG AAAGAAGCTGAAGAGCGTACCGAGTTACGTATTAGGGCCCTGGCTAATACTCGGCCAATG GAACCTCGGTACAACGGCCATGTTCCCCTTCATCGGTACGAGAAATTGCTGCTGTTTGCA ATTTCCGGTTGGAATTCATTTTTCCATCCTGAAGATGGTTATAATATTGTACAATTGGGT GAGGCAACTGCATTGCCGGTCTTCTTGGAGAATTTGAAGCAAACAATGTTAAGTGATTCC TCTGGGAGGCGCATTTTGAAGGAACAACCCAATATCACAACAGAGATTTTGCATATGGAC AAACTAGCTAAATTGCCACATAACACGTTTGGGTATGTATATTACCAATGGTTGAAAAGA GAAAACGTTTCTCCGGACACTAGAGCACCTGTCAAATTTATCGACGATCCTATGCATGCA TATATCTTTAAGAGGTATAGACAATGCCACGATTTCTATCACGCTATAACCAACATGCCT ATTATCATTGAGGGGGAGATCACCATAAAGGCTCTTGAAGGTGCCAACCTGGGCGTCCCA ATGGCCATTCTCGGTGGTATCCTTGCACCTTTACGTTTGAAAAAGGTGCAAAGAAAAAGA TTATATAATATATATCTCCCTTGGGCTGTCAGAACAGGTTTAAGCTGCAAGCCATTGATC AACGTGTATTGGGAGGAAATGCTGGAGAAGGATGTTACTGCTTTGAGGAAAGAGCTAAAG ATAACACTCCCTCCGGATCTAAGGACAATGAGGAAGGAGCGTGCAGCCCTTAGGAAGGAG ATTGACGCAAAATACAACTCACAGAAACGAGCCACGACTCCAGCATGA
Protein Properties
Pfam Domain Function
Protein Residues335
Protein Molecular Weight38626.80078
Protein Theoretical pI10.13
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ubiquinone biosynthesis protein COQ4, mitochondrial MLRLSLLRSTATLPVKCQRRGLILPAAAMYTLGSLIFGKEARLADAMERGELHNKNVDYA KEAEERTELRIRALANTRPMEPRYNGHVPLHRYEKLLLFAISGWNSFFHPEDGYNIVQLG EATALPVFLENLKQTMLSDSSGRRILKEQPNITTEILHMDKLAKLPHNTFGYVYYQWLKR ENVSPDTRAPVKFIDDPMHAYIFKRYRQCHDFYHAITNMPIIIEGEITIKALEGANLGVP MAILGGILAPLRLKKVQRKRLYNIYLPWAVRTGLSCKPLINVYWEEMLEKDVTALRKELK ITLPPDLRTMRKERAALRKEIDAKYNSQKRATTPA
References
External Links
ResourceLink
Saccharomyces Genome Database COQ4
Uniprot IDO13525
Uniprot NameCOQ4_YEAST
GenBank Gene IDZ68194
Genebank Protein ID1204149
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Belogrudov, G. I., Lee, P. T., Jonassen, T., Hsu, A. Y., Gin, P., Clarke, C. F. (2001). "Yeast COQ4 encodes a mitochondrial protein required for coenzyme Q synthesis." Arch Biochem Biophys 392:48-58.11469793
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Gin, P., Clarke, C. F. (2005). "Genetic evidence for a multi-subunit complex in coenzyme Q biosynthesis in yeast and the role of the Coq1 hexaprenyl diphosphate synthase." J Biol Chem 280:2676-2681.15548532
  • Marbois, B., Gin, P., Faull, K. F., Poon, W. W., Lee, P. T., Strahan, J., Shepherd, J. N., Clarke, C. F. (2005). "Coq3 and Coq4 define a polypeptide complex in yeast mitochondria for the biosynthesis of coenzyme Q." J Biol Chem 280:20231-20238.15792955
  • Tran, U. C., Marbois, B., Gin, P., Gulmezian, M., Jonassen, T., Clarke, C. F. (2006). "Complementation of Saccharomyces cerevisiae coq7 mutants by mitochondrial targeting of the Escherichia coli UbiF polypeptide: two functions of yeast Coq7 polypeptide in coenzyme Q biosynthesis." J Biol Chem 281:16401-16409.16624818
  • Hsieh, E. J., Gin, P., Gulmezian, M., Tran, U. C., Saiki, R., Marbois, B. N., Clarke, C. F. (2007). "Saccharomyces cerevisiae Coq9 polypeptide is a subunit of the mitochondrial coenzyme Q biosynthetic complex." Arch Biochem Biophys 463:19-26.17391640
  • Marbois, B., Gin, P., Gulmezian, M., Clarke, C. F. (2009). "The yeast Coq4 polypeptide organizes a mitochondrial protein complex essential for coenzyme Q biosynthesis." Biochim Biophys Acta 1791:69-75.19022396