Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial 2-oxodicarboxylate carrier 2
SynonymsNot Available
Gene NameODC2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transporter activity
Specific FunctionTransports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2- oxoglutarate, adipate, glutarate, 2-oxopimelate, oxaloacetate, citrate and malate. The main physiological role is probably to supply 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol where they are used in the biosynthesis of lysine and glutamate, respectively, and in lysine catabolism
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00142Oxoadipic acidShow
YMDB00153Oxoglutaric acidShow
GO Classification
Component
organelle membrane
organelle inner membrane
mitochondrial inner membrane
cell part
membrane
Function
binding
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 15
LocusYOR222W
Gene Sequence>924 bp ATGTCATCAGACTCAAACGCAAAGCCATTGCCTTTTATATATCAGTTCATATCAGGTGCC GTCGCCGGTATTTCTGAGTTAACTGTTATGTATCCGCTTGATGTTGTTAAGACAAGATTT CAACTGGAGGTGACGACGCCTACTGCCGCTGCAGTAGGAAAGCAAGTAGAGAGATATAAT GGTGTCATCGATTGTTTGAAAAAAATTGTAAAGAAGGAAGGGTTTAGCAGACTTTACAGA GGTATTAGTTCACCAATGTTGATGGAAGCACCAAAGAGAGCCACCAAATTTGCATGTAAC GATCAATATCAAAAAATCTTCAAAAACCTATTCAACACGAATGAAACTACGCAGAAGATC TCCATTGCGGCTGGTGCATCTGCTGGTATGACAGAAGCTGCAGTTATTGTTCCATTTGAA TTGATCAAAATCAGGATGCAAGACGTCAAGTCCAGCTATCTTGGACCAATGGACTGTTTG AAAAAAACAATCAAAAACGAAGGTATTATGGGGCTATACAAGGGTATCGAATCTACCATG TGGAGAAACGCTCTTTGGAATGGTGGCTACTTCGGTGTTATCTACCAAGTGAGAAATTCC ATGCCCGTAGCAAAGACAAAGGGACAAAAGACCAGAAATGACCTTATTGCAGGTGCGATC GGTGGTACGGTCGGGACCATGCTTAACACTCCCTTTGACGTGGTGAAATCCAGAATCCAA AGTGTGGACGCGGTCAGCAGTGCTGTTAAAAAATACAACTGGTGCCTACCTTCGCTATTG GTCATATACCGTGAAGAAGGCTTCAGAGCATTGTACAAAGGTTTCGTCCCCAAAGTATGT AGACTAGCACCCGGTGGTTCATTAATGTTGGTGGTTTTTACCGGTATGATGAACTTTTTC AGGGATCTGAAGTACGGACACTGA
Protein Properties
Pfam Domain Function
Protein Residues307
Protein Molecular Weight34006.69922
Protein Theoretical pI10.22
Signalling Regions
  • None
Transmembrane Regions
  • 10-30
  • 76-95
  • 122-142
  • 171-191
  • 215-235
  • 280-300
Protein Sequence>Mitochondrial 2-oxodicarboxylate carrier 2 MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI SIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM WRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF RDLKYGH
References
External Links
ResourceLink
Saccharomyces Genome Database ODC2
Uniprot IDQ99297
Uniprot NameODC2_YEAST
GenBank Gene IDX92441
Genebank Protein ID1050774
General Reference
  • Galisson, F., Dujon, B. (1996). "Sequence and analysis of a 33 kb fragment from the right arm of chromosome XV of the yeast Saccharomyces cerevisiae." Yeast 12:877-885.8840505
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Palmieri, L., Agrimi, G., Runswick, M. J., Fearnley, I. M., Palmieri, F., Walker, J. E. (2001). "Identification in Saccharomyces cerevisiae of two isoforms of a novel mitochondrial transporter for 2-oxoadipate and 2-oxoglutarate." J Biol Chem 276:1916-1922.11013234