You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEnoyl reductase TSC13
Synonyms
  • Temperature-sensitive CSG2 suppressor protein 13
  • Trans-2-enoyl-CoA reductase
Gene NameTSC13
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the CH-CH group of donors
Specific FunctionComponent of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long chain fatty acids (VLCFA) from palmitate. Catalyzes the last step in each elongation cycle that lengthens palmitate by two carbon units. VLCFAs serve as precursors for ceramide and sphingolipids. Required for normal biogenesis of piecemeal microautophagy of the nucleus (PMN) bleps and vesicles during nutrient stress
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein.
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
Fatty acid elongation in mitochondriaPW002467 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
Fatty acid elongation in mitochondriaec00062 Map00062
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
intracellular part
cytoplasm
Function
oxidoreductase activity, acting on the CH-CH group of donors
catalytic activity
oxidoreductase activity
Process
metabolic process
primary metabolic process
lipid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL015C
Gene Sequence>933 bp ATGCCTATCACCATAAAAAGCCGCTCTAAAGGGTTAAGGGACACTGAAATTGACTTATCC AAAAAGCCTACTTTAGATGATGTTTTGAAAAAAATCTCTGCTAATAACCACAATATCAGC AAGTACAGGATAAGATTAACCTACAAAAAGGAATCTAAACAAGTTCCGGTTATTTCAGAA TCGTTTTTTCAAGAAGAGGCTGATGACTCAATGGAATTCTTCATCAAAGATTTGGGTCCC CAAATTTCATGGAGATTAGTCTTCTTTTGTGAGTATTTGGGTCCAGTCTTGGTTCACTCC CTTTTTTATTATCTATCTACCATTCCCACAGTTGTTGATAGATGGCACAGTGCTAGCTCC GACTATAATCCATTTTTAAACAGGGTTGCATATTTTTTAATTTTAGGACATTATGGAAAG AGATTATTTGAAACCTTATTTGTTCACCAATTCTCTTTAGCTACTATGCCAATTTTCAAC CTGTTCAAAAATTGTTTCCATTACTGGGTTCTAAGCGGTCTCATTTCATTCGGTTACTTT GGCTACGGCTTCCCCTTTGGGAATGCTAAGTTATTCAAATACTATTCATATTTGAAATTG GATGACTTGAGTACATTAATTGGTCTTTTCGTGCTTTCAGAACTATGGAACTTTTATTGC CACATTAAATTGCGCCTATGGGGTGACTATCAAAAGAAGCATGGTAACGCTAAGATCCGT GTCCCATTGAATCAAGGTATTTTCAATCTTTTTGTTGCTCCCAACTATACTTTTGAAGTT TGGTCTTGGATTTGGTTTACTTTTGTGTTCAAGTTCAATTTATTTGCCGTTTTATTTTTG ACTGTTTCAACAGCTCAAATGTACGCATGGGCTCAAAAGAAAAACAAAAAGTATCATACC AGAAGAGCATTCTTGATTCCATTTGTATTTTGA
Protein Properties
Pfam Domain Function
Protein Residues310
Protein Molecular Weight36767.5
Protein Theoretical pI9.96
Signalling Regions
  • None
Transmembrane Regions
  • 86-106
  • 142-162
  • 166-186
  • 202-222
  • 243-265
  • 269-291
Protein Sequence>Enoyl reductase TSC13 MPITIKSRSKGLRDTEIDLSKKPTLDDVLKKISANNHNISKYRIRLTYKKESKQVPVISE SFFQEEADDSMEFFIKDLGPQISWRLVFFCEYLGPVLVHSLFYYLSTIPTVVDRWHSASS DYNPFLNRVAYFLILGHYGKRLFETLFVHQFSLATMPIFNLFKNCFHYWVLSGLISFGYF GYGFPFGNAKLFKYYSYLKLDDLSTLIGLFVLSELWNFYCHIKLRLWGDYQKKHGNAKIR VPLNQGIFNLFVAPNYTFEVWSWIWFTFVFKFNLFAVLFLTVSTAQMYAWAQKKNKKYHT RRAFLIPFVF
References
External Links
ResourceLink
Saccharomyces Genome Database TSC13
Uniprot IDQ99190
Uniprot NameTSC13_YEAST
GenBank Gene IDZ48432
Genebank Protein ID683682
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Kohlwein, S. D., Eder, S., Oh, C. S., Martin, C. E., Gable, K., Bacikova, D., Dunn, T. (2001). "Tsc13p is required for fatty acid elongation and localizes to a novel structure at the nuclear-vacuolar interface in Saccharomyces cerevisiae." Mol Cell Biol 21:109-125.11113186
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kvam, E., Gable, K., Dunn, T. M., Goldfarb, D. S. (2005). "Targeting of Tsc13p to nucleus-vacuole junctions: a role for very-long-chain fatty acids in the biogenesis of microautophagic vesicles." Mol Biol Cell 16:3987-3998.15958487
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258