You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA pseudouridine synthase 1
Synonyms
  • tRNA pseudouridylate synthase 1
  • tRNA-uridine isomerase 1
Gene NamePUS1
Enzyme Class
Biological Properties
General FunctionInvolved in RNA binding
Specific FunctionFormation of pseudouridine at positions 27 and 28 in the anticodon stem and loop of transfer RNAs; at positions 34 and 36 of intron-containing precursor tRNA(Ile) and at position 35 in the intron-containing tRNA(Tyr)
Cellular LocationNucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Uracil + alpha-D-ribose 5-phosphatewater + Pseudouridine 5'-phosphate
Metabolites
YMDB IDNameView
YMDB00098UracilShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00780Pseudouridine 5'-phosphateShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
isomerase activity
intramolecular transferase activity
nucleic acid binding
pseudouridine synthase activity
RNA binding
Process
pseudouridine synthesis
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
RNA modification
Gene Properties
Chromosome Locationchromosome 16
LocusYPL212C
Gene Sequence>1635 bp ATGTCTGAAGAGAATTTGAGGCCTGCCTATGACGATCAAGTTAATGAGGATGTCTACAAG AGAGGCGCTCAGAGCAAATTGACCAAAGCTCGTAAGGCAGACTTCGACGATGAAAAGGAC AAAAAAAAGGATAATGACAAACACATAGATAAAAGACCAAAAAGCGGTCCTCGTTTGGAT GAAAATGGCAATCCACTTCCCAAGGAGCCTCGTCTCCCAAAGAGAAAGGTGGCTGTTATG GTTGGTTACTGTGGTACTGGCTACCATGGTATGCAATATAATCCACCAAATCCAACCATC GAGTCTGCCCTATTCAAAGCATTTGTTGAAGCAGGTGCTATTTCCAAGGACAACTCCAAC GATTTGAAAAAGAATGGATTCATGAGAGCTGCAAGAACTGATAAGGGTGTCCATGCTGGA GGTAATTTAATATCATTGAAAATGATTATTGAAGATCCTGATATCAAGCAGAAGATCAAC GAAAAGTTACCGGAAGGGATAAGGGTATGGGATATCGAGCGTGTGAACAAGGCGTTTGAT TGTAGAAAAATGTGCAGTTCACGTTGGTACGAATACTTATTACCAACTTATTCACTCATT GGCCCCAAACCTGGTTCTATACTTTATAGAGACATCGAAGAAAGTAAAACAGAATTACCT GGTGTATTAGATGAAGATTTGGAATCCAAAGAATTTTGGGAAGAGTTTAAAAAAGATGCG AATGAAAAATTTTCAACAGAAGAAATCGAAGCTATATTAGCATATGTTCCGCCCGCAAGA GATGAATTTGATATAAATGAAGAACTATACCAGAAGGTAAAAAAGTACAAGCAATTAGAA AATGCTCACCGTAGAAGATATCGTATATCCGCGGCAAAACTGGCCAAATTCCGTGCTTCT ACAAGTCAATACCTTGGCGCTCATAACTTCCATAATTTTACATTAGGCAAGGACTTCAAA GAACCAAGTGCCATTCGATTTATGAAAGATATAAAAGTATCTGATCCATTTGTTATTGGC GATGCCCAAACAGAATGGATTTCCATCAAGATTCACGGCCAGTCTTTCATGCTACATCAA ATTCGTAAGATGGTATCAATGGCAACCTTAATTACCCGTTGTGGTTGCCCCGTCGAACGC ATTAGTCAGGCTTACGGACAGCAGAAGATTAATATTCCGAAGGCACCTGCATTAGGATTA TTGTTAGAAGCTCCAGTATTTGAAGGTTATAATAAAAGACTAGAACAGTTTGGTTACAAG GCGATCGATTTTTCCAAATATCAAGACGAAGTGGATAAGTTCAAAATGAAGCATATCTAC GATAAGATCTACAAGGAAGAGGTGGACGAAAATGTTTTTAATGCGTTCTTTAGTTATATT GATAGTTTCAACAAGGTTACTGGAGCACAGGGAGAAGAAACTGCCGATAAATCGGGACCT GCTGTGCAAAAGAGTATCTTCGAATTCTTGACAGCTAAGGGTATCCCAGGTCTTACTGAT GCGCCCGAGAGCAATAAGAAGATTAAGCAAAGAAAAAGAATGGAAGAGGAGGAAGCTGCT AGTAAAAAGGCTGAAATATCCAGCACCACTCAGAGCAACGAACCTGAAGTACAACCGGAA GCGGCAGCTAATTAG
Protein Properties
Pfam Domain Function
Protein Residues544
Protein Molecular Weight62142.0
Protein Theoretical pI8.37
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA pseudouridine synthase 1 MSEENLRPAYDDQVNEDVYKRGAQSKLTKARKADFDDEKDKKKDNDKHIDKRPKSGPRLD ENGNPLPKEPRLPKRKVAVMVGYCGTGYHGMQYNPPNPTIESALFKAFVEAGAISKDNSN DLKKNGFMRAARTDKGVHAGGNLISLKMIIEDPDIKQKINEKLPEGIRVWDIERVNKAFD CRKMCSSRWYEYLLPTYSLIGPKPGSILYRDIEESKTELPGVLDEDLESKEFWEEFKKDA NEKFSTEEIEAILAYVPPARDEFDINEELYQKVKKYKQLENAHRRRYRISAAKLAKFRAS TSQYLGAHNFHNFTLGKDFKEPSAIRFMKDIKVSDPFVIGDAQTEWISIKIHGQSFMLHQ IRKMVSMATLITRCGCPVERISQAYGQQKINIPKAPALGLLLEAPVFEGYNKRLEQFGYK AIDFSKYQDEVDKFKMKHIYDKIYKEEVDENVFNAFFSYIDSFNKVTGAQGEETADKSGP AVQKSIFEFLTAKGIPGLTDAPESNKKIKQRKRMEEEEAASKKAEISSTTQSNEPEVQPE AAAN
References
External Links
ResourceLink
Saccharomyces Genome Database PUS1
Uniprot IDQ12211
Uniprot NamePUS1_YEAST
GenBank Gene IDX80673
Genebank Protein ID1403091
General Reference
  • Simos, G., Tekotte, H., Grosjean, H., Segref, A., Sharma, K., Tollervey, D., Hurt, E. C. (1996). "Nuclear pore proteins are involved in the biogenesis of functional tRNA." EMBO J 15:2270-2284.8641292
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Motorin, Y., Keith, G., Simon, C., Foiret, D., Simos, G., Hurt, E., Grosjean, H. (1998). "The yeast tRNA:pseudouridine synthase Pus1p displays a multisite substrate specificity." RNA 4:856-869.9671058
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Arluison, V., Hountondji, C., Robert, B., Grosjean, H. (1998). "Transfer RNA-pseudouridine synthetase Pus1 of Saccharomyces cerevisiae contains one atom of zinc essential for its native conformation and tRNA recognition." Biochemistry 37:7268-7276.9585540
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106