You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable ferric reductase transmembrane component 8
Synonyms
  • Ferric-chelate reductase 8
Gene NameFRE8
Enzyme Class
Biological Properties
General FunctionInvolved in iron ion binding
Specific FunctionRequired for the uptake of Fe(3+) ions. May participate in the transport of electrons from cytoplasm to an extracellular substrate (Fe(3+) ion) via FAD and heme intermediates. Involved in iron homeostasis
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00194Iron(3+)Show
YMDB00379Iron(2+)Show
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
catalytic activity
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
oxidoreductase activity
binding
electron carrier activity
nucleoside binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLR047C
Gene Sequence>2061 bp ATGAATTTAAAGTCCATCGTTAGCTGGTTCAAGGAACATCTTCCCAGTTTTGATGTCGAC GTGGACAAGCATTTTAGAACTTTAAGAGTCCGCAAATATTCTCAGATATGTCTTTTAATT TCTTTCATTATAATATGTGTTATTATACCCTTAATGAATTATTTGTTGCTAACTGACAAA TTCTTCAAAATATGTCACCATTTAAAGCATCATGTTTTCAACAGAAGATCATGGGTTCAC AAAACACATATGTATCACAAACAGTCACTACAACTATGTTTAATATGCTTTGTTTTCACC TCGTTTTTTGTTATACAAGGCGCTAACGGAGATCTGTTAGAAATTACTAAGCGAATGGGG AGAATTTCCGTTGCTTTGATGCCACCTTTACTATTTCTAACGTTGAGGCCATCACCGTTA CCTCACACGTTATACTTAGCATTGTTACCTCTCCACAAATGGATTTCCAGAATTGTTGTG CTTGAATCTATTCTACACACGTGGTTCTATCTCTATTACATGTACATTAATGATACGTTA TACGTGAAAATGAGAAAACTACCCAACATTTATGGGGTTATTGCCCTCGGCCTTTTCCTA CTGATTGCCATCACCTCTGTGAGATATGCCAGACGATGGAGCTACAGAGTTTTTTACTAT GTTCACTATGTAAGCACATGGCTTATTTTGGTGTTTCTACATTATCACGCTCGCCCAGGA ATTTCATATTATACCACTTTAAATGTGCTCATATTAACGGGACAAATCGTCTATAGGCTC CATATCACCAATGTTACGAGAGTTACGATAGTACCCATTTCTTCATCATTGTCTCTTTTG GAGTTCCCATTAACCGATTTACCCAAAAAGCCCATCCTACCAGGAGGGCATCTAAGGATC AACATTTACCATAGAAATTTTTTAAGGAGGTTTTTCTCCCATTTGATACCCTTCCAACAT CCTTTTACTATTGCTAGTATTCCAAGTGATAATTTGGTCAGGTTAATTATTAGAAACGGG CATTTTCCATTGCGTACAAATGAAAAGTATTACATTACAGGGGCTTTTGAACCTGAGTTG AGTTTCATTTCTAAACCTACTGTTCCTTTTAATATTACCACGAAATCTTCCAAGAATCCA TTTCGAAACAATTCTTCTGCACTAATAAATTCGCCTTTAAATTTTCTAATTAAAGCGCAA AGAGTGTTTATGTGTGTTGGAGGTTCAGGAATTTCCTTTGGCTTACCACTACTTCGTATT CTAAACTTCAACGGTGTAAACGTTAGGCTCCTTTGGGTTTCTAGAGATTATAAGGATCTG GAAGTATTGAACCACTTCAAAAACAATTTTGAAGGTATGGAGATATATATTAGTGGCACC GAAGGCAACGAACAGGACATAGAAATTGATTATATTGACTATCATGACTGCGCTGCTGAT ATTAATGATGAAGTCAGGAGTATTTCTTCGAGCGGCCGAGTTTCAGAACTGGGAGATAAT TCCATGTTATCAGATGGAAATCCCCAACCTACGGAGCCCAATGAGAACACAGCCCTTCTA AGTAAGAAATCTACCTTGAGAAACCATCACCCACCAAAAACAAGTGATATACCTGACATC AATGCTGATGACGAGATAGATTTTACATATGCTTTTAGCAGATCCAAATCAAGGAAAAAT ACTGCACAAGGAACTCTAACTACACATTCTTCGTTTAACGGATCGAGCGTTTTCAGACAA CCAAAGATCATTGAGCCACCTGCCCAAGATCCTTGTTTAGAGGCGGCGCCTAAAAAGATC AGAATTCCCGCAGGTGTTAAAGTGTTCTTTGGCAGGCCTACACTTGGAGATAAGGATTAT GAATGGTGTCTGCAAACCGAATGTGATGCAGAGACGGATTCTATTCAATGTTGCAGGTGG GCGAATCAAGGCAGAGACCATGCTGAATATTTGTCACAAGTATGGGTTCTCGCTGCAGGC CCTAGAGGCTTAATTGAAAGCACCAAAAGATGGGCGACAGATGGTGGTTTACACTTTCAC GGAGAAAGTTTTGCATTATAA
Protein Properties
Pfam Domain Function
Protein Residues686
Protein Molecular Weight78947.70313
Protein Theoretical pI9.43
Signalling Regions
  • None
Transmembrane Regions
  • 36-56
  • 90-110
  • 129-149
  • 158-178
  • 187-207
  • 217-237
  • 268-288
  • 403-423
Protein Sequence>Probable ferric reductase transmembrane component 8 MNLKSIVSWFKEHLPSFDVDVDKHFRTLRVRKYSQICLLISFIIICVIIPLMNYLLLTDK FFKICHHLKHHVFNRRSWVHKTHMYHKQSLQLCLICFVFTSFFVIQGANGDLLEITKRMG RISVALMPPLLFLTLRPSPLPHTLYLALLPLHKWISRIVVLESILHTWFYLYYMYINDTL YVKMRKLPNIYGVIALGLFLLIAITSVRYARRWSYRVFYYVHYVSTWLILVFLHYHARPG ISYYTTLNVLILTGQIVYRLHITNVTRVTIVPISSSLSLLEFPLTDLPKKPILPGGHLRI NIYHRNFLRRFFSHLIPFQHPFTIASIPSDNLVRLIIRNGHFPLRTNEKYYITGAFEPEL SFISKPTVPFNITTKSSKNPFRNNSSALINSPLNFLIKAQRVFMCVGGSGISFGLPLLRI LNFNGVNVRLLWVSRDYKDLEVLNHFKNNFEGMEIYISGTEGNEQDIEIDYIDYHDCAAD INDEVRSISSSGRVSELGDNSMLSDGNPQPTEPNENTALLSKKSTLRNHHPPKTSDIPDI NADDEIDFTYAFSRSKSRKNTAQGTLTTHSSFNGSSVFRQPKIIEPPAQDPCLEAAPKKI RIPAGVKVFFGRPTLGDKDYEWCLQTECDAETDSIQCCRWANQGRDHAEYLSQVWVLAAG PRGLIESTKRWATDGGLHFHGESFAL
References
External Links
ResourceLink
Saccharomyces Genome Database FRE8
Uniprot IDQ12209
Uniprot NameFRE8_YEAST
GenBank Gene IDX94607
Genebank Protein ID1181268
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • De Freitas, J. M., Kim, J. H., Poynton, H., Su, T., Wintz, H., Fox, T., Holman, P., Loguinov, A., Keles, S., van der Laan, M., Vulpe, C. (2004). "Exploratory and confirmatory gene expression profiling of mac1Delta." J Biol Chem 279:4450-4458.14534306
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258