You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial tRNA-specific 2-thiouridylase 1
Synonyms
  • Mitochondrial translation optimization protein 2
  • Synthetic lethal with MSS4 3
Gene NameSLM3
Enzyme Class
Biological Properties
General FunctionTranslation, ribosomal structure and biogenesis
Specific FunctionCatalyzes the 2-thiolation of uridine at the wobble position (U34) of mitochondrial tRNA(Lys), tRNA(Glu) and tRNA(Gln). Required for the formation of 5-taurinomethyl-2- thiouridine (tm5s2U) of mitochondrial tRNA(Lys), tRNA(Glu), and tRNA(Gln) at the wobble position. ATP is required to activate the C2 atom of the wobble base
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00438S-Adenosyl-L-methionineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
transferase activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA processing
Gene Properties
Chromosome Locationchromosome 4
LocusYDL033C
Gene Sequence>1254 bp ATGCTGGCAAGATATTTAAATTTAATAGGACGGAGGAGTGCTTCACCGTACAGACCACAG CGGCTACCGGCAAAGTTTGACAACGTGATAGTGGCAATGTCATCTGGGGTAGATTCCTCT GTGGCGGCAGCACTATTTGCCGGAGAATTTCCAAATACCCGAGGAGTATATATGCAGAAC TGGTCTGAATCACAATCTTTGGACGACCCTGGCAAGGAGCCATGCTACGAGAGGGATTGG AGAGATGTGAACCGTGTCGCTAAGCATTTGAACATCCGAGTTGACAAAGTTAATTTTGAG CAAGATTATTGGATAGATGTATTTGAACCAATGTTGAGAGGCTACAGTGAAGGGTCGACA CCCAATCCAGATATCGGTTGCAACAAGTTCGTCAAGTTCGGCAAGCTGAGAGAGTGGCTG GATGAGAAGTATGGGACGGGTAACTATTGGCTTGTTACTGGTCATTACGCCCGAGTTATG CAGGAAATGAATGGAAAAGGATTATTCCATTTACTGAGAAGCATTTATAGGCCCAAGGAT CAAAGCTATTACCTTTCACAAATCAACTCCACTGTTTTGTCATCTTTGTTGCTACCCATT GGCCATCTAACGAAACCAGAAGTACGAGATTTAGCGAAGTATGCAGGCCTCCCGACTGCA GAAAAGCCTGATTCACAGGGCATATGCTTCGTCAACAATTCCCAGCATGGGAAGTTCAAG AATTTTTTAAAGCACTACCTACCCAGTTCACCGGGTGATATCATTACCGTTGACCCACAA TCCGGTGCCAAAACGACATGGGGCAGACACGATGGATTGTGGTCTTACACAATTGGACAG AAAGTGGGCATATCCATGCCACAAGCTGACCCTAATTACCAAGGGACCTGGTTTGTCAGT GAAAAACTAAGGGATACCAACGAAATCTTGATAGTCAGAGGAAGAGATAATCCGGCGCTA TACAGTGACACTATGCGAATCGAAAACTTTTCGTCTTTGGGCCCCAGGGAGGACACTATA AACGCTTTCCAAAATACTGGTGCCTTGACATTACAATTCCGGTCCCTGCAGGTCCCAGTC CAAATTAAATCGTGCAAACTGAATCGCTCTGCCGACAACCTCGACATAACAATACACTTA GCCTCAAAACAACGTGCCATAACTCCTGGGCAATCGTGCTGTCTATATATCGACGATAGA GTCCTTGGGAGTGGGCCCATTTCCCATGTTAATAATAATGACACCCATGCATAG
Protein Properties
Pfam Domain Function
Protein Residues417
Protein Molecular Weight47048.80078
Protein Theoretical pI8.69
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Mitochondrial tRNA-specific 2-thiouridylase 1 MLARYLNLIGRRSASPYRPQRLPAKFDNVIVAMSSGVDSSVAAALFAGEFPNTRGVYMQN WSESQSLDDPGKEPCYERDWRDVNRVAKHLNIRVDKVNFEQDYWIDVFEPMLRGYSEGST PNPDIGCNKFVKFGKLREWLDEKYGTGNYWLVTGHYARVMQEMNGKGLFHLLRSIYRPKD QSYYLSQINSTVLSSLLLPIGHLTKPEVRDLAKYAGLPTAEKPDSQGICFVNNSQHGKFK NFLKHYLPSSPGDIITVDPQSGAKTTWGRHDGLWSYTIGQKVGISMPQADPNYQGTWFVS EKLRDTNEILIVRGRDNPALYSDTMRIENFSSLGPREDTINAFQNTGALTLQFRSLQVPV QIKSCKLNRSADNLDITIHLASKQRAITPGQSCCLYIDDRVLGSGPISHVNNNDTHA
References
External Links
ResourceLink
Saccharomyces Genome Database SLM3
Uniprot IDQ12093
Uniprot NameMTU1_YEAST
GenBank Gene IDAY624369
Genebank Protein ID48478823
General Reference
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Tatusov, R. L., Galperin, M. Y., Natale, D. A., Koonin, E. V. (2000). "The COG database: a tool for genome-scale analysis of protein functions and evolution." Nucleic Acids Res 28:33-36.10592175
  • Wang, X., Yan, Q., Guan, M. X. (2007). "Deletion of the MTO2 gene related to tRNA modification causes a failure in mitochondrial RNA metabolism in the yeast Saccharomyces cerevisiae." FEBS Lett 581:4228-4234.17706197
  • Yan, Q., Li, X., Faye, G., Guan, M. X. (2005). "Mutations in MTO2 related to tRNA modification impair mitochondrial gene expression and protein synthesis in the presence of a paromomycin resistance mutation in mitochondrial 15 S rRNA." J Biol Chem 280:29151-29157.15944150
  • Umeda, N., Suzuki, T., Yukawa, M., Ohya, Y., Shindo, H., Watanabe, K., Suzuki, T. (2005). "Mitochondria-specific RNA-modifying enzymes responsible for the biosynthesis of the wobble base in mitochondrial tRNAs. Implications for the molecular pathogenesis of human mitochondrial diseases." J Biol Chem 280:1613-1624.15509579
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867