You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFerric reductase transmembrane component 5
Synonyms
  • Ferric-chelate reductase 5
Gene NameFRE5
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCell surface metalloreductase
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00194Iron(3+)Show
YMDB00379Iron(2+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
catalytic activity
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
oxidoreductase activity
binding
nucleoside binding
electron carrier activity
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 15
LocusYOR384W
Gene Sequence>2085 bp ATGCTTTTCGCTAGATTAGTGCTGCTGTTGGTGTATTTGGCACCAGGTTCTTTAGCAAAA CCAGCATCAACTAAGAAAAGAACGCAATGGGACCAGATAGCAATTGATGCTTGTGCTAAA GAATTGGAATCACACAAATTTGACACGGATGTGAAGGGTCGGCACGCTACTCTTTGCACT TATGAACCAGCACTAGGGTCTTGGTTACATTGCGCGAAGGATGTTCTCGACAGTAGGAAG AAAAGTAAAAAAATATTCGAAAAAACGTTTAGCAAAATTAATCAGTATTGCCACGATTAT CACAAAGATGAGGTCGTCAGCAATGAGGAGTATTATCGAATTTTTGCCAATGCATCCCTT TTCATCCGGCCTCTTGATGAGGTAAAGGAAAACATACGATATCCCGTCACTCCCAATAAA GCCTCTCTAGATAGGTGGGTATGGGCTTATTTTGGGCCCCTGGATAATATAGACAAAGGA AATGTTTATGGAGTGACGATTTGCTTATACTGGATAGGAGTTCTGTTTATTGCAGCTGTA TATCACTTCTTGAACTTTTCTCGACTTAAACAAACGGTGTTCAAAAACAAGGTGTCTGCT TTCTTAAGAGGCCACTATGTTCTTCCAGCGCTTGTTCATAACCATGCTATGTCAGTGGGA AGGTGGTTTTTCATCGGTCTGGTCCCTACCAGGTTAGAGACCCTTGTCCTATTCGGTTAC GTTTTGTTGCACGGGTTCTTGTTGAGTAGTTACAATTTTGACCATAATGAGTTGCTCAGT GATCGCAGAAGCCAAGTGCTTATCTTCCTTTCCGACAGGGCAGGGATCCTGGCATTCGCA CATTTTCCTTTGATAGTTCTCTTTGGCGGTAAAAACAGCACAATGACTTGGCTCACAGGT ATAAGATATACCGCATTCATTACTTACCACAAATGGTTAGGAAGATTCATGTTAGTAGAC TGTACGATCCATGCAATAGGATACACCTACCATGCATACATAGAAAATTACTGGAAATAC GTGAAGTATAGTGATCTATGGACATCCGGAAGACATGCCATGATCATTGTTGGAATACTT GTGTTTTTTTCGTTCTTCTTCTTTAGACGACATTATTACGAATTGTTTGTTATTACGCAC ATTATCTTAGCAATAGGATTTTTCCATGCGTGCTGGAAACATTGCTATAAACTTGGATGG GGTGAATGGATAATGGCGTGTGCACTGTTTTGGATTGCTGACCGTATTCTGCGGCTAATA AAGATTGCAATTTTTGGAATGCCATGGGCTAAATTGAAACTGTGTGGCGAGTCCATGATA GAAGTGAGAATCTCAAAAAGCTCCAAATGGTGGAAAGCAGAACCTGGCCAATATATATAT CTGTACTTCTTAAGACCAAAAATATTCTGGCAATCACATCCATTCACGGTCATGGATTCT TTGGTTGAGGATGGTGAGTTGGTAGTTGTGATAACAGTGAAAAATGGGCTAACCAAAAAA TTACAGGAATACCTTTTAGAGAGCGAAGGGTACACGGAAATGCGAGTACTAGCAGAAGGA CCTTATGGACAAAGCACGCGAACACATTTGTTCGAAAGCCTCCTGTTTATTGCCGGAGGG GCGGGTGTTCCTGGACCTCTGTCGATGGCAATAAAGGCAGGTCGCCAGGTCAAAAGCAAC GATTCTCATCAAATGATCAAATTTGTGTGGAGTGTACGTAACCTTGATCTCTTAGAAGTG TATCGCAAAGAGATAATGGTGCTAAAAGAGTTGAACATAGACACAAAAATTTACTTCACA GGAGAGCGAAAAGATGAATCGAACACGGAGGAGGGAGCAATTGCTAATATGAGCACGGAA GGCAGACTGCTGACGACATCGAAATCAGCGGAAATGATTACTGATTTTGGACGACCAAAT ATCGATGAGATAATTGAAGAAGCAGTAAGTGGTGCAAAATCTTTGTTGGTCACTTGTTGC GGGTCAGAGGGCTTTGTAGACAAGACACGAGAGTTGACGGCAAAAAGAGTTCTTGAACAC GGTGACAAATGGATAGAATACGTGGAGGAATTCCAGAATTGGTAG
Protein Properties
Pfam Domain Function
Protein Residues694
Protein Molecular Weight80291.70313
Protein Theoretical pI8.84
Signalling Regions
  • 1-19
Transmembrane Regions
  • 164-184
  • 223-243
  • 268-288
  • 312-334
  • 348-368
  • 372-392
  • 404-424
Protein Sequence>Ferric reductase transmembrane component 5 MLFARLVLLLVYLAPGSLAKPASTKKRTQWDQIAIDACAKELESHKFDTDVKGRHATLCT YEPALGSWLHCAKDVLDSRKKSKKIFEKTFSKINQYCHDYHKDEVVSNEEYYRIFANASL FIRPLDEVKENIRYPVTPNKASLDRWVWAYFGPLDNIDKGNVYGVTICLYWIGVLFIAAV YHFLNFSRLKQTVFKNKVSAFLRGHYVLPALVHNHAMSVGRWFFIGLVPTRLETLVLFGY VLLHGFLLSSYNFDHNELLSDRRSQVLIFLSDRAGILAFAHFPLIVLFGGKNSTMTWLTG IRYTAFITYHKWLGRFMLVDCTIHAIGYTYHAYIENYWKYVKYSDLWTSGRHAMIIVGIL VFFSFFFFRRHYYELFVITHIILAIGFFHACWKHCYKLGWGEWIMACALFWIADRILRLI KIAIFGMPWAKLKLCGESMIEVRISKSSKWWKAEPGQYIYLYFLRPKIFWQSHPFTVMDS LVEDGELVVVITVKNGLTKKLQEYLLESEGYTEMRVLAEGPYGQSTRTHLFESLLFIAGG AGVPGPLSMAIKAGRQVKSNDSHQMIKFVWSVRNLDLLEVYRKEIMVLKELNIDTKIYFT GERKDESNTEEGAIANMSTEGRLLTTSKSAEMITDFGRPNIDEIIEEAVSGAKSLLVTCC GSEGFVDKTRELTAKRVLEHGDKWIEYVEEFQNW
References
External Links
ResourceLink
Saccharomyces Genome Database FRE5
Uniprot IDQ08908
Uniprot NameFRE5_YEAST
GenBank Gene IDAY692958
Genebank Protein ID51013367
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Martins, L. J., Jensen, L. T., Simon, J. R., Keller, G. L., Winge, D. R. (1998). "Metalloregulation of FRE1 and FRE2 homologs in Saccharomyces cerevisiae." J Biol Chem 273:23716-23721.9726978
  • Georgatsou, E., Alexandraki, D. (1999). "Regulated expression of the Saccharomyces cerevisiae Fre1p/Fre2p Fe/Cu reductase related genes." Yeast 15:573-584.10341420