You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphorelay intermediate protein YPD1
Synonyms
  • Histidine-containing phosphotransfer protein YPD1
  • Tyrosine phosphatase-dependent protein 1
Gene NameYPD1
Enzyme ClassNot Available
Biological Properties
General Functionphosphorylation
Specific FunctionPhosphorelay intermediate protein that is part of the branched SLN1-YPD1-SKN7/SSK1 two-component regulatory system, which controls activity of the HOG1 pathway and gene expression in response to changes in the osmolarity of the extracellular environment. Catalyzes the phosphoryl group transfer from the membrane-bound osmosensing histidine kinase SLN1 to two distinct response regulator proteins, SSK1 in the cytoplasm, and transcription factor SKN7 in the nucleus.
Cellular LocationNot Available
SMPDB Pathways
Stress-activated signalling pathways: high osmolarityPW002516 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: high osmolarity 1469654356PW002970 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: high osmolarity test 1PW002773 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: low osmolarityPW002515 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
protein histidine kinase binding
phosphorylation
transferase activity, transferring phosphorus-containing groups
nucleus
cytoplasm
histidine phosphotransfer kinase activity
osmosensory signaling via phosphorelay pathway
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>504 bp ATGTCTACTATTCCCTCAGAAATCATCAATTGGACCATCTTAAATGAAATTATATCTATG GATGACGATGATTCCGATTTTTCTAAAGGTCTAATTATTCAATTTATCGACCAGGCACAA ACAACTTTTGCTCAAATGCAACGACAGCTGGACGGTGAAAAAAATCTTACCGAATTAGAC AATCTGGGCCATTTTTTAAAGGGTTCTTCTGCTGCATTAGGCTTACAAAGAATTGCCTGG GTTTGTGAAAGAATTCAAAACTTGGGAAGAAAAATGGAACATTTCTTCCCCAACAAGACC GAATTGGTCAACACTCTGAGCGATAAATCGATTATTAATGGAATCAATATTGATGAAGAT GACGAGGAAATAAAGATACAAGTGGACGATAAAGACGAAAATTCCATATATCTCATCTTG ATAGCAAAAGCTTTGAACCAGTCTAGGTTGGAGTTCAAACTGGCGAGAATTGAGTTATCT AAATATTACAACACAAACCTATAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues167
Protein Molecular Weight19168.48
Protein Theoretical pINot Available
PDB Fileshow
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Phosphorelay intermediate protein YPD1 MSTIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELD NLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDED DEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
References
External Links
ResourceLink
Saccharomyces Genome Database YPD1
Uniprot IDQ07688
Uniprot NameYPD1
PDB ID
1C02
General ReferenceNot Available