You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative pyridoxal reductase
Synonyms
  • PL reductase
  • PL-red
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the reduction of pyridoxal (PL) with NADPH and oxidation of pyridoxine (PN) with NADP(+)
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Vitamin B6 metabolismec00750 Map00750
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00037PyridoxineShow
YMDB00392PyridoxalShow
YMDB00426NADPHShow
YMDB00427NADPShow
GO Classification
Component
Not Available
Function
catalytic activity
oxidoreductase activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome LocationNot Available
LocusYPR127W
Gene Sequence>1038 bp ATGTCTGTCGCCGATTTGAAAAACAACATCCACAAGTTAGATACTGGCTATGGTTTAATG AGTTTGACTTGGAGAGCCGAGCCTATCCCTCAGTCGCAGGCTTTCGAGGCCATGCACAGA GTGGTTGAGTTATCCAGAGAACGTGGGCACAAGGCCTTTTTCAACGTTGGTGAATTCTAT GGTCCCGATTTTATTAATTTGTCGTATGTTCACGACTTCTTTGCGAAATACCCAGATTTG AGAAAGGATGTGGTTATCAGTTGTAAAGGTGGTGCAGACAATGCTACCTTAACCCCCAGA GGCAGTCACGATGATGTTGTACAAAGCGTAAAGAATTCAGTTAGTGCTATTGGTGGCTAC ATCGACATCTTCGAAGTCGCAAGAATCGACACTTCCCTATGCACGAAAGGAGAGGTCTAC CCCTACGAATCGTTCGAAGCGCTTGCTGAGATGATCTCCGAAGGCGTTATTGGCGGTATT TCATTAAGTGAAGTTAATGAAGAGCAAATTAGAGCTATTCACAAGGATTGGGGAAAGTTT TTGACCTGCGTTGAAGTGGAACTTTCTTTGTTCAGTAATGACATTTTACACAACGGAATT GCTAAAACATGTGCTGAATTGGGGTTGTCCATCATCTGCTACTCCCCACTGGGCAGAGGA TTGTTGACAGGTCAATTGAAGTCAAACGCTGATATCCCTGAGGGTGACTTTAGAAAGTCG TTAAAGAGATTTAGCGACGAGTCTTTGAAAAAAAACCTGACCTTGGTCAGGTTTCTACAG GAAGAAATAGTCGACAAGCGCCCACAAAACAACTCCATTACTCTTGCACAACTGGCTTTG GGATGGGTTAAGCACTGGAACAAAGTTCCGGAATACAGTGGCGCCAAATTTATCCCAATT CCAAGTGGCTCTTCTATTTCCAAGGTTAATGAAAACTTTGATGAACAGAAAACCAAACTT ACCGATCAAGAGTTCAATGCCATTAACAAATATTTGACTACTTTCCATACTGTTGGTGAC AGATACGAAATGGCGTAA
Protein Properties
Pfam Domain Function
Protein Residues345
Protein Molecular Weight38600.39844
Protein Theoretical pI5.85
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative pyridoxal reductase MSVADLKNNIHKLDTGYGLMSLTWRAEPIPQSQAFEAMHRVVELSRERGHKAFFNVGEFY GPDFINLSYVHDFFAKYPDLRKDVVISCKGGADNATLTPRGSHDDVVQSVKNSVSAIGGY IDIFEVARIDTSLCTKGEVYPYESFEALAEMISEGVIGGISLSEVNEEQIRAIHKDWGKF LTCVEVELSLFSNDILHNGIAKTCAELGLSIICYSPLGRGLLTGQLKSNADIPEGDFRKS LKRFSDESLKKNLTLVRFLQEEIVDKRPQNNSITLAQLALGWVKHWNKVPEYSGAKFIPI PSGSSISKVNENFDEQKTKLTDQEFNAINKYLTTFHTVGDRYEMA
References
External Links
ResourceLink
Saccharomyces Genome Database YPR127W
Uniprot IDQ06494
Uniprot NamePLR1_YEAST
GenBank Gene IDU40828
Genebank Protein ID1066468
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956