Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethylthioribose-1-phosphate isomerase
Synonyms
  • M1Pi
  • MTR-1-P isomerase
  • S-methyl-5-thioribose-1-phosphate isomerase
Gene NameMRI1
Enzyme Class
Biological Properties
General FunctionInvolved in cellular metabolic process
Specific FunctionCatalyzes the interconversion of methylthioribose-1- phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1- P)
Cellular LocationNot Available
SMPDB Pathways
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
SMPDB Reactions
5-Methylthioribose 1-phosphate5-Methylthioribulose 1-phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB000405-Methylthioribose 1-phosphateShow
YMDB001295-Methylthioribulose 1-phosphateShow
GO Classification
Component
Not Available
Function
Not Available
Process
metabolic process
biosynthetic process
cellular metabolic process
cellular biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR118W
Gene Sequence>1236 bp ATGTCGTTGGAAGCCATCGTCTTTGATAGATCGGAGCCAGAAAATGTTTCGGTAAAGGTA CTTGATCAATTACTTTTACCATATACTACTAAATACGTTCCAATTCACACAATTGATGAT GGGTACTCAGTCATCAAAAGTATGCAGGTGAGAGGTGCCCCGGCAATTGCAATTGTGGGT TCGTTATCTGTTTTGACTGAGGTACAATTAATAAAACACAACCCAACTTCTGATGTTGCT ACGCTGTATTCTTTAGTTAACTGGGAATCTACAAAAACAGTGCTAAATAAGAGGCTAGAT TTCCTTTTGAGTAGTAGACCCACAGCCGTTAATTTATCAAATTCTCTTGTAGAGATAAAG AACATACTGAAATCCTCAAGTGACCTAAAGGCTTTTGACGGTAGTTTATATAATTACGTC TGTGAATTGATAGATGAGGATTTGGCGAATAACATGAAAATGGGTGATAATGGAGCTAAG TATTTGATTGACGTGTTACAAAAGGACGGTTTCAAGGACGAATTTGCCGTTCTGACGATT TGTAATACTGGATCCTTAGCAACCTCTGGATATGGCACGGCTTTAGGTGTTATCCGTTCT TTGTGGAAGGATTCACTTGCTAAAACCGACAAGGCAGACTCGGGATTGGACAATGAAAAA TGCCCGAGGATGGGCCATGTCTTCCCACTGGAAACTAGACCTTATAATCAAGGGTCAAGG CTAACAGCATACGAGCTAGTTTATGATAAGATTCCATCAACTTTAATTACTGATAGTTCC ATCGCGTATAGAATTAGAACTAGTCCAATTCCAATCAAAGCAGCATTTGTTGGAGCTGAT AGAATTGTTCGTAATGGGGATACAGCAAATAAAATTGGTACTTTACAACTTGCTGTAATT TGTAAGCAGTTCGGAATTAAGTTTTTTGTAGTAGCTCCCAAAACAACTATCGATAATGTA ACCGAAACTGGCGATGACATTATTGTGGAAGAACGTAACCCTGAGGAATTCAAGGTTGTT ACTGGTACAGTAATTAATCCTGAAAATGGTTCCTTGATATTGAATGAGTCAGGAGAGCCA ATCACTGGAAAGGTCGGTATTGCCCCTCTTGAAATCAATGTCTGGAATCCAGCCTTCGAC ATTACTCCACATGAGCTTATTGACGGAATTATCACAGAAGAAGGTGTATTTACCAAAAAT TCCAGTGGTGAATTTCAACTGGAAAGCCTTTTCTAG
Protein Properties
Pfam Domain Function
Protein Residues411
Protein Molecular Weight45019.89844
Protein Theoretical pI4.64
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methylthioribose-1-phosphate isomerase MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVG SLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIK NILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTI CNTGSLATSGYGTALGVIRSLWKDSLAKTDKADSGLDNEKCPRMGHVFPLETRPYNQGSR LTAYELVYDKIPSTLITDSSIAYRIRTSPIPIKAAFVGADRIVRNGDTANKIGTLQLAVI CKQFGIKFFVVAPKTTIDNVTETGDDIIVEERNPEEFKVVTGTVINPENGSLILNESGEP ITGKVGIAPLEINVWNPAFDITPHELIDGIITEEGVFTKNSSGEFQLESLF
References
External Links
ResourceLink
Saccharomyces Genome Database MRI1
Uniprot IDQ06489
Uniprot NameMTNA_YEAST
GenBank Gene IDU40828
Genebank Protein ID1066474
PDB ID
1W2W
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Bumann, M., Djafarzadeh, S., Oberholzer, A. E., Bigler, P., Altmann, M., Trachsel, H., Baumann, U. (2004). "Crystal structure of yeast Ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eIF2B subunits." J Biol Chem 279:37087-37094.15215245