You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial 2-oxodicarboxylate carrier 1
SynonymsNot Available
Gene NameODC1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transporter activity
Specific FunctionTransports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2- oxoglutarate, adipate, glutarate, 2-oxopimelate, oxaloacetate, citrate and malate. The main physiological role is probably to supply 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol where they are used in the biosynthesis of lysine and glutamate, respectively, and in lysine catabolism
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00142Oxoadipic acidShow
YMDB00153Oxoglutaric acidShow
GO Classification
Component
organelle membrane
organelle inner membrane
mitochondrial inner membrane
cell part
membrane
Function
binding
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 16
LocusYPL134C
Gene Sequence>933 bp ATGACATCTATAGATAATAGACCTTTGCCGTTCATATACCAGTTCACAGCCGGTGCCATT GCCGGCGTCTCGGAGCTATTGGTGATGTATCCATTGGACGTGGTGAAGACAAGAATGCAA TTACAAGTGACAACCAAAGGTCATCCCGCTGTTGTTGCAGCGAAAGCAGCAGTAGATCAC TACACGGGCGTGATGGATTGTCTTACAAAAATTGTGAAGAAGGAAGGATTTTCGCATCTT TACAAGGGTATCACATCGCCTATATTAATGGAGGCTCCGAAAAGAGCAATTAAGTTCTCC GGAAACGATACATTCCAAACGTTTTATAAAAAGATTTTCCCCACGCCCAATGGGGAGATG ACTCAAAAAATCGCCATATACAGTGGTGCGTCCGCTGGCGCCGTGGAAGCCTTTGTCGTC GCGCCTTTTGAACTAGTGAAGATTAGATTACAGGATGTGAATTCACAGTTCAAGACACCC ATTGAAGTTGTAAAGAATAGTGTTGTGAAAGGTGGTGTTTTGTCACTTTTCAATGGGTTG GAAGCCACTATCTGGAGACACGTTCTTTGGAATGCCGGTTATTTCGGTATAATATTCCAA ATTCGGAAGCTTTTGCCGGCGGCTAAAACAAGCACGGAAAAGACCAGAAATGATTTGATC GCAGGTGCTATTGGTGGCACTGTCGGGTGCTTGTTGAATACACCATTTGACGTGGTAAAA TCTAGGATCCAAAGAAGTTCCGGGCCGCTGAGGAAGTACAACTGGTCCCTGCCTTCAGTG CTGTTAGTTTACCGTGAGGAAGGGTTTAAAGCATTGTATAAGGGATTTGCGCCAAAGGTC ATGAGACTTGCCCCCGGTGGTGGGTTATTGTTGGTAGTTTTCACGAACGTCATGGATTTT TTCAGAGAAGTCAAGTATGGTAAAAAACAATGA
Protein Properties
Pfam Domain Function
Protein Residues310
Protein Molecular Weight34206.0
Protein Theoretical pI10.45
Signalling Regions
  • None
Transmembrane Regions
  • 9-29
  • 78-97
  • 126-146
  • 179-199
  • 219-239
  • 281-301
Protein Sequence>Mitochondrial 2-oxodicarboxylate carrier 1 MTSIDNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDH YTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEM TQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGL EATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVK SRIQRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDF FREVKYGKKQ
References
External Links
ResourceLink
Saccharomyces Genome Database ODC1
Uniprot IDQ03028
Uniprot NameODC1_YEAST
GenBank Gene IDU43703
Genebank Protein ID1244780
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Palmieri, L., Agrimi, G., Runswick, M. J., Fearnley, I. M., Palmieri, F., Walker, J. E. (2001). "Identification in Saccharomyces cerevisiae of two isoforms of a novel mitochondrial transporter for 2-oxoadipate and 2-oxoglutarate." J Biol Chem 276:1916-1922.11013234
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106